PPOX (NM_001122764) Human Recombinant Protein
CAT#: TP325811
Recombinant protein of human protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg
View other "PPOX" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC225811 protein sequence
Red=Cloning site Green=Tags(s) MGRTVVVLGGGISGLAASYHLSRAPCPPKVVLVESSERLGGWIRSVRGPNGAIFELGPRGIRPAGALGAR TLLLVSELGLDSEVLPVRGDHPAAQNRFLYVGGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGK EPDETVHSFAQRRLGPEVASLAMDSLCRGVFAGNSRELSIRSCFPSLFQAEQTHRSILLGLLLGAGRTPQ PDSALIRQALAERWSQWSLRGGLEMLPQALETHLTSRGVSVLRGQPVCGLSLQAEGRWKVSLRDSSLEAD HVISAIPASVLSELLPAEAAPLARALSAITAVSVAVVNLQYQGAHLPVQGFGHLVPSSEDPGVLGIVYDS VAFPEQDGSPPGLRVTVMLGGSWLQTLEASGCVLSQELFQQRAQEAAATQLGLKEMPSHCLVHLHKNCIP QYTLGHWQKLESARQFLTAHRLPLTLAGASYEGVAVNDCIESGRQAAVSVLGTEPNS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001116236 |
Locus ID | 5498 |
UniProt ID | P50336 |
Refseq Size | 1777 |
Cytogenetics | 1q23.3 |
Refseq ORF | 1431 |
Synonyms | PPO; V290M; VP |
Summary | This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Porphyrin and chlorophyll metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424808 | PPOX HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC426558 | PPOX HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY424808 | Transient overexpression lysate of protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CN¥ 3,080.00 |
|
LY426558 | Transient overexpression lysate of protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CN¥ 3,080.00 |
|
PH301788 | PPOX MS Standard C13 and N15-labeled recombinant protein (NP_000300) |
CN¥ 19,520.00 |
|
PH325811 | PPOX MS Standard C13 and N15-labeled recombinant protein (NP_001116236) |
CN¥ 19,520.00 |
|
TP301788 | Recombinant protein of human protoporphyrinogen oxidase (PPOX), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CN¥ 2,900.00 |