SPAG11B (NM_058201) Human Recombinant Protein
CAT#: TP324764
Recombinant protein of human sperm associated antigen 11B (SPAG11B), transcript variant D, 20 µg
View other "SPAG11B" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224764 representing NM_058201
Red=Cloning site Green=Tags(s) MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPY QGDVPPGIRNTICRMQQGICRLFFCHSGEKKRDICSDPWNRCCVSNTDEEGKEKPEMDGRSGI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 12.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_478108 |
Locus ID | 10407 |
UniProt ID | Q08648 |
Refseq Size | 718 |
Cytogenetics | 8p23.1 |
Refseq ORF | 399 |
Synonyms | EDDM2B; EP2; EP2C; EP2D; HE2; HE2C; SPAG11; SPAG11A |
Summary | This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409232 | SPAG11B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409232 | Transient overexpression lysate of sperm associated antigen 11B (SPAG11B), transcript variant D |
CNY 3,080.00 |
|
PH324764 | SPAG11B MS Standard C13 and N15-labeled recombinant protein (NP_478108) |
CNY 19,520.00 |
其它SPAG11B产品