SPAG11B (NM_058201) Human Mass Spec Standard
CAT#: PH324764
SPAG11B MS Standard C13 and N15-labeled recombinant protein (NP_478108)
View other "SPAG11B" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SPAG11B MS Standard C13 and N15-labeled recombinant protein (NP_478108) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224764 |
Predicted MW | 12.1 kDa |
Protein Sequence |
>RC224764 representing NM_058201
Red=Cloning site Green=Tags(s) MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELRERAPGQGTNGFQLLRHAVKRDLLPPRTPPY QGDVPPGIRNTICRMQQGICRLFFCHSGEKKRDICSDPWNRCCVSNTDEEGKEKPEMDGRSGI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_478108 |
RefSeq Size | 718 |
RefSeq ORF | 399 |
Synonyms | EDDM2B; EP2; EP2C; EP2D; HE2; HE2C; SPAG11; SPAG11A |
Locus ID | 10407 |
Cytogenetics | 8p23.1 |
Summary | This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409232 | SPAG11B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409232 | Transient overexpression lysate of sperm associated antigen 11B (SPAG11B), transcript variant D |
CNY 3,080.00 |
|
TP324764 | Recombinant protein of human sperm associated antigen 11B (SPAG11B), transcript variant D, 20 µg |
CNY 2,900.00 |
其它SPAG11B产品