Peroxiredoxin 5 (PRDX5) (NM_181651) Human Recombinant Protein
CAT#: TP324020
Recombinant protein of human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg
View other "Peroxiredoxin 5" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC224020 representing NM_181651
Red=Cloning site Green=Tags(s) MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEG EPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMV VQDGIVKALNVEPDGTGLTCSLAPNIISQL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 17.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_857634 |
Locus ID | 25824 |
UniProt ID | P30044 |
Refseq Size | 781 |
Cytogenetics | 11q13.1 |
Refseq ORF | 510 |
Synonyms | ACR1; AOEB166; B166; HEL-S-55; PLP; PMP20; PRDX6; prx-V; PRXV; SBBI10 |
Summary | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome/cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene. [provided by RefSeq, Nov 2017] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402144 | PRDX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC405741 | PRDX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY402144 | Transient overexpression lysate of peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CN¥ 3,080.00 |
|
LY405741 | Transient overexpression lysate of peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CN¥ 3,080.00 |
|
PH310709 | PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_036226) |
CN¥ 19,520.00 |
|
PH317362 | PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_857635) |
CN¥ 19,520.00 |
|
PH324020 | PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_857634) |
CN¥ 19,520.00 |
|
TP310709 | Recombinant protein of human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP317362 | Recombinant protein of human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CN¥ 2,900.00 |
其它Peroxiredoxin 5产品