Peroxiredoxin 5 (PRDX5) (NM_012094) Human Mass Spec Standard
CAT#: PH310709
PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_036226)
View other "Peroxiredoxin 5" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_036226) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210709 |
Predicted MW | 22 kDa |
Protein Sequence |
>RC210709 protein sequence
Red=Cloning site Green=Tags(s) MGLAGVCALRRSAGYILVGGAGGQSAAAAARRCSEGEWASGGVRSFSRAAAAMAPIKVGDAIPAVEVFEG EPGNKVNLAELFKGKKGVLFGVPGAFTPGCSKTHLPGFVEQAEALKAKGVQVVACLSVNDAFVTGEWGRA HKAEGKVRLLADPTGAFGKETDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI ISQL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036226 |
RefSeq Size | 913 |
RefSeq ORF | 642 |
Synonyms | ACR1; AOEB166; B166; HEL-S-55; PLP; PMP20; PRDX6; prx-V; PRXV; SBBI10 |
Locus ID | 25824 |
Cytogenetics | 11q13.1 |
Summary | This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein interacts with peroxisome receptor 1 and plays an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. The use of alternate transcription start sites is thought to result in transcript variants that use different in-frame translational start codons to generate isoforms that are targeted to the mitochondrion (isoform L) or peroxisome/cytoplasm (isoform S). Multiple related pseudogenes have been defined for this gene. [provided by RefSeq, Nov 2017] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402144 | PRDX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC405741 | PRDX5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402144 | Transient overexpression lysate of peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
LY405741 | Transient overexpression lysate of peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 3 |
CNY 3,080.00 |
|
PH317362 | PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_857635) |
CNY 19,520.00 |
|
PH324020 | PRDX5 MS Standard C13 and N15-labeled recombinant protein (NP_857634) |
CNY 19,520.00 |
|
TP310709 | Recombinant protein of human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP317362 | Recombinant protein of human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP324020 | Recombinant protein of human peroxiredoxin 5 (PRDX5), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Peroxiredoxin 5产品