Exosome Component 9 (EXOSC9) (NM_001034194) Human Recombinant Protein
CAT#: TP323537
Recombinant protein of human exosome component 9 (EXOSC9), transcript variant 1, 20 µg
View other "Exosome Component 9" proteins (3)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC223537 representing NM_001034194
Red=Cloning site Green=Tags(s) MKETPLSNCERRFLLRAIEEKKRLDGRQTYDYRNIRISFGTDYGCCIVELGKTRVLGQVSCELVSPKLNR ATEGILFFNLELSQMAAPAFEPGRQSDLLVKLNRLMERCLRNSKCIDTESLCVVAGEKVWQIRVDLHLLN HDGNIIDAASIAAIVALCHFRRPDVSVQGDEVTLYTPEERDPVPLSIHHMPICVSFAFFQQGTYLLVDPN EREERVMDGLLVIAMNKHREICTIQSSGGIMLLKDQVLRCSKIAGVKVAEITELILKALENDQKVRKEGG KFGFAESIANQRITAFKMEKAPIDTSDVEEKAEEIIAEAEPPSEVVSTPVLWTPGTAQIGEGVENSWGDL EDSEKEDDEGGGDQAIILDGIKMDTGVEVSDIGSQELGFHHVGQTGLEFLTSDAPIILSDSEEEEMIILE PDKNPKKIRTQTTSAKQEKAPSKKPVKRRKKKRAAN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 50.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001029366 |
Locus ID | 5393 |
UniProt ID | Q06265 |
Refseq Size | 1644 |
Cytogenetics | 4q27 |
Refseq ORF | 1368 |
Synonyms | p5; p6; PCH1D; PM/Scl-75; PMSCL1; RRP45; Rrp45p |
Summary | This gene encodes a component of the human exosome, a exoribonuclease complex which processes and degrades RNA in the nucleus and cytoplasm. This component may play a role in mRNA degradation and the polymyositis/scleroderma autoantigen complex. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2011] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | RNA degradation |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421960 | EXOSC9 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY421960 | Transient overexpression lysate of exosome component 9 (EXOSC9), transcript variant 1 |
CN¥ 4,840.00 |
|
PH323537 | EXOSC9 MS Standard C13 and N15-labeled recombinant protein (NP_001029366) |
CN¥ 19,520.00 |
其它Exosome Component 9产品