United States
Germany
Japan
United Kingdom
China
CCK4 (PTK7) (NM_152880) Human Recombinant Protein
CAT＃: TP323416
Recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-2, 20 µg
View other "CCK4" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC223416 representing NM_152880
Red=Cloning site Green=Tags(s) MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGA PVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEI QPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQAC SSQNFTLSIADESFARVVLAPQDVVVARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATV FANGSLLLTQVRPRNAGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLP EPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVATVPSWLKKPQD SQLEEGKPGYLDCLTQATPKPTVVWYRNQMLISEDSRFEVFKNGTLRINSVEVYDGTWYRCMSSTPAGSI EAQARVQVLDGSSLPEWVTDNAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPER TTVYQGHTALLQCEAQGDPKPLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSC NIKHTEAPLYVVDKPVPEESEGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPE GEEPEMECLNGGPLQNGQPSAEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEV FLAKAQGLEEGVAETLVLVKSLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDL GDLKQFLRISKSKDEKLKSQPLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALG LSKDVYNSEYYHFRQAWVPLRWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQ AGKARLPQPEGCPSKLYRLMQRCWALSPKDRPSFSEIASALGDSTVDSKP myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 110.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_690619 |
| Locus ID | 5754 |
| UniProt ID | Q13308 |
| Refseq Size | 4129 |
| Cytogenetics | 6p21.1 |
| Refseq ORF | 3090 |
| Synonyms | CCK-4; CCK4 |
| Summary | This gene encodes a member of the receptor protein tyrosine kinase family of proteins that transduce extracellular signals across the cell membrane. The encoded protein lacks detectable catalytic tyrosine kinase activity, is involved in the Wnt signaling pathway and plays a role in multiple cellular processes including polarity and adhesion. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
| Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
PTK7-Targeting CAR T-cells for the Treatment of Lung Cancer and other Malignancies
,Jie, Y;Liu, G;Feng, L;Li, Y;E, M;Wu, L;Rong, G;Li, Y;Wei, H;Gu, A;,
Research Square
[PTK7]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC407251 | PTK7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY407251 | Transient overexpression lysate of PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3 |
CNY 4,840.00 |
|
| PH320322 | PTK7 MS Standard C13 and N15-labeled recombinant protein (NP_690620) |
CNY 19,520.00 |
|
| PH323416 | PTK7 MS Standard C13 and N15-labeled recombinant protein (NP_690619) |
CNY 19,520.00 |
|
| TP320322 | Recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3, 20 µg |
CNY 2,900.00 |
|
| TP700163 | Purified recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
| TP700164 | Purified recombinant protein of human protein tyrosine kinase 7 (PTK7), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
| TP700165 | Purified recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
| TP710169 | Purified recombinant protein of Human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-1, residues 31-704aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
