CCK4 (PTK7) (NM_152881) Human Recombinant Protein
CAT#: TP320322
Recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3, 20 µg
View other "CCK4" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220322 representing NM_152881
Red=Cloning site Green=Tags(s) MGAARGSPARPRRLPLLSVLLLPLLGGTQTAIVFIKQPSSQDALQGRRALLRCEVEAPGPVHVYWLLDGA PVQDTERRFAQGSSLSFAAVDRLQDSGTFQCVARDDVTGEEARSANASFNIKWIEAGPVVLKHPASEAEI QPQTQVTLRCHIDGHPRPTYQWFRDGTPLSDGQSNHTVSSKERNLTLRPAGPEHSGLYSCCAHSAFGQAC SSQNFTLSIADESFARVVLAPQDVVVARYEEAMFHCQFSAQPPPSLQWLFEDETPITNRSRPPHLRRATV FANGSLLLTQVRPRNAGIYRCIGQGQRGPPIILEATLHLAEIEDMPLFEPRVFTAGSEERVTCLPPKGLP EPSVWWEHAGVRLPTHGRVYQKGHELVLANIAESDAGVYTCHAANLAGQRRQDVNITVANGSSLPEWVTD NAGTLHFARVTRDDAGNYTCIASNGPQGQIRAHVQLTVAVFITFKVEPERTTVYQGHTALLQCEAQGDPK PLIQWKGKDRILDPTKLGPRMHIFQNGSLVIHDVAPEDSGRYTCIAGNSCNIKHTEAPLYVVDKPVPEES EGPGSPPPYKMIQTIGLSVGAAVAYIIAVLGLMFYCKKRCKAKRLQKQPEGEEPEMECLNGGPLQNGQPS AEIQEEVALTSLGSGPAATNKRHSTSDKMHFPRSSLQPITTLGKSEFGEVFLAKAQGLEEGVAETLVLVK SLQSKDEQQQLDFRRELEMFGKLNHANVVRLLGLCREAEPHYMVLEYVDLGDLKQFLRISKSKDEKLKSQ PLSTKQKVALCTQVALGMEHLSNNRFVHKDLAARNCLVSAQRQVKVSALGLSKDVYNSEYYHFRQAWVPL RWMSPEAILEGDFSTKSDVWAFGVLMWEVFTHGEMPHGGQADDEVLADLQAGKARLPQPEGCPSKLYRLM QRCWALSPKDRPSFSEIASALGDSTVDSKP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 100.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_690620 |
Locus ID | 5754 |
UniProt ID | Q13308 |
Refseq Size | 3859 |
Cytogenetics | 6p21.1 |
Refseq ORF | 2820 |
Synonyms | CCK-4; CCK4 |
Summary | This gene encodes a member of the receptor protein tyrosine kinase family of proteins that transduce extracellular signals across the cell membrane. The encoded protein lacks detectable catalytic tyrosine kinase activity, is involved in the Wnt signaling pathway and plays a role in multiple cellular processes including polarity and adhesion. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Jul 2012] |
Protein Families | Druggable Genome, Protein Kinase, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC407251 | PTK7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY407251 | Transient overexpression lysate of PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3 |
CNY 4,840.00 |
|
PH320322 | PTK7 MS Standard C13 and N15-labeled recombinant protein (NP_690620) |
CNY 19,520.00 |
|
PH323416 | PTK7 MS Standard C13 and N15-labeled recombinant protein (NP_690619) |
CNY 19,520.00 |
|
TP323416 | Recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-2, 20 µg |
CNY 2,900.00 |
|
TP700163 | Purified recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-1, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP700164 | Purified recombinant protein of human protein tyrosine kinase 7 (PTK7), transcript variant 2, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP700165 | Purified recombinant protein of human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-3, with C-terminal DDK/His tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP710169 | Purified recombinant protein of Human PTK7 protein tyrosine kinase 7 (PTK7), transcript variant PTK7-1, residues 31-704aa, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |