D4S234E (NSG1) (NM_014392) Human Recombinant Protein
CAT#: TP322554
Recombinant protein of human DNA segment on chromosome 4 (unique) 234 expressed sequence (D4S234E), transcript variant 1, 20 µg
View other "D4S234E" proteins (5)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222554 representing NM_014392
Red=Cloning site Green=Tags(s) MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGKARPPQIAEFT VSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKNTQCIPEGLESYYAEQDSSAR EKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 20.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_055207 |
Locus ID | 27065 |
UniProt ID | P42857 |
Refseq Size | 1517 |
Cytogenetics | 4p16.3 |
Refseq ORF | 555 |
Synonyms | D4S234; D4S234E; NEEP21; P21 |
Summary | Plays a role in the recycling mechanism in neurons of multiple receptors, including AMPAR, APP and L1CAM and acts at the level of early endosomes to promote sorting of receptors toward a recycling pathway. Regulates sorting and recycling of GRIA2 through interaction with GRIP1 and then contributes to the regulation of synaptic transmission and plasticity by affecting the recycling and targeting of AMPA receptors to the synapse (By similarity). Is required for faithful sorting of L1CAM to axons by facilitating trafficking from somatodendritic early endosome or the recycling endosome (By similarity). In an other hand, induces apoptosis via the activation of CASP3 in response to DNA damage (PubMed:20599942, PubMed:20878061).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415315 | NSG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421674 | NSG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415315 | Transient overexpression lysate of DNA segment on chromosome 4 (unique) 234 expressed sequence (D4S234E), transcript variant 1 |
CNY 3,080.00 |
|
LY421674 | Transient overexpression lysate of DNA segment on chromosome 4 (unique) 234 expressed sequence (D4S234E), transcript variant 2 |
CNY 3,080.00 |
|
PH322554 | D4S234E MS Standard C13 and N15-labeled recombinant protein (NP_055207) |
CNY 19,520.00 |
其它D4S234E产品