D4S234E (NSG1) (NM_014392) Human Mass Spec Standard
CAT#: PH322554
D4S234E MS Standard C13 and N15-labeled recombinant protein (NP_055207)
View other "D4S234E" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | D4S234E MS Standard C13 and N15-labeled recombinant protein (NP_055207) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222554 |
Predicted MW | 20.7 kDa |
Protein Sequence |
>RC222554 representing NM_014392
Red=Cloning site Green=Tags(s) MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGKARPPQIAEFT VSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKNTQCIPEGLESYYAEQDSSAR EKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_055207 |
RefSeq Size | 1517 |
RefSeq ORF | 555 |
Synonyms | D4S234; D4S234E; NEEP21; P21 |
Locus ID | 27065 |
Cytogenetics | 4p16.3 |
Summary | Plays a role in the recycling mechanism in neurons of multiple receptors, including AMPAR, APP and L1CAM and acts at the level of early endosomes to promote sorting of receptors toward a recycling pathway. Regulates sorting and recycling of GRIA2 through interaction with GRIP1 and then contributes to the regulation of synaptic transmission and plasticity by affecting the recycling and targeting of AMPA receptors to the synapse (By similarity). Is required for faithful sorting of L1CAM to axons by facilitating trafficking from somatodendritic early endosome or the recycling endosome (By similarity). In an other hand, induces apoptosis via the activation of CASP3 in response to DNA damage (PubMed:20599942, PubMed:20878061).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415315 | NSG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421674 | NSG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY415315 | Transient overexpression lysate of DNA segment on chromosome 4 (unique) 234 expressed sequence (D4S234E), transcript variant 1 |
CNY 3,080.00 |
|
LY421674 | Transient overexpression lysate of DNA segment on chromosome 4 (unique) 234 expressed sequence (D4S234E), transcript variant 2 |
CNY 3,080.00 |
|
TP322554 | Recombinant protein of human DNA segment on chromosome 4 (unique) 234 expressed sequence (D4S234E), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它D4S234E产品