GTSF1L (NM_001008901) Human Recombinant Protein
CAT#: TP322477
Recombinant protein of human gametocyte specific factor 1-like (GTSF1L), transcript variant 2, 20 µg
View other "GTSF1L" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222477 representing NM_001008901
Red=Cloning site Green=Tags(s) MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVE EEDTENPLKVSPPSSEQNDDTQQTFFPQKVVCENDTKESARETSPQKILRPGQ myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008901 |
Locus ID | 149699 |
UniProt ID | Q9H1H1 |
Refseq Size | 773 |
Cytogenetics | 20q13.12 |
Refseq ORF | 369 |
Synonyms | C20orf65; dJ1028D15.4; FAM112A |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422897 | GTSF1L HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY422897 | Transient overexpression lysate of gametocyte specific factor 1-like (GTSF1L), transcript variant 2 |
CN¥ 3,080.00 |
|
PH322477 | GTSF1L MS Standard C13 and N15-labeled recombinant protein (NP_001008901) |
CN¥ 19,520.00 |
|
TP710312 | Purified recombinant protein of Human gametocyte specific factor 1-like (GTSF1L), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CN¥ 4,020.00 |