GTSF1L (NM_001008901) Human Mass Spec Standard
CAT#: PH322477
GTSF1L MS Standard C13 and N15-labeled recombinant protein (NP_001008901)
View other "GTSF1L" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
Specifications
Product Data | |
Description | GTSF1L MS Standard C13 and N15-labeled recombinant protein (NP_001008901) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222477 |
Predicted MW | 14 kDa |
Protein Sequence |
>RC222477 representing NM_001008901
Red=Cloning site Green=Tags(s) MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVE EEDTENPLKVSPPSSEQNDDTQQTFFPQKVVCENDTKESARETSPQKILRPGQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001008901 |
RefSeq Size | 773 |
RefSeq ORF | 369 |
Synonyms | C20orf65; dJ1028D15.4; FAM112A |
Locus ID | 149699 |
Cytogenetics | 20q13.12 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC422897 | GTSF1L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY422897 | Transient overexpression lysate of gametocyte specific factor 1-like (GTSF1L), transcript variant 2 |
CNY 3,080.00 |
|
TP322477 | Recombinant protein of human gametocyte specific factor 1-like (GTSF1L), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP710312 | Purified recombinant protein of Human gametocyte specific factor 1-like (GTSF1L), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |