Adenylate kinase 5 (AK5) (NM_174858) Human Recombinant Protein
CAT#: TP322241
Recombinant protein of human adenylate kinase 5 (AK5), transcript variant 1, 20 µg
View other "Adenylate kinase 5" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC222241 representing NM_174858
Red=Cloning site Green=Tags(s) MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPL NGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGG PGSGKGTQSLKIAERYGFQYISVGELLRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIP DEEGIVIDGFPRDVAQALSFEDQICTPDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQ NAAPLVKYFQEKGLIMTFDADRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDY EDQGDDQLNVFGEDTMGGFMEDLRKCKIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESE RSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSA DTMTNRLLQRSRSSLPVDDTTKTIAKRLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDS IF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 63.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_777283 |
Locus ID | 26289 |
UniProt ID | Q9Y6K8 |
Refseq Size | 3257 |
Cytogenetics | 1p31.1 |
Refseq ORF | 1686 |
Synonyms | AK6 |
Summary | This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403569 | AK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC415983 | AK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY403569 | Transient overexpression lysate of adenylate kinase 5 (AK5), transcript variant 1 |
CN¥ 3,080.00 |
|
LY415983 | Transient overexpression lysate of adenylate kinase 5 (AK5), transcript variant 2 |
CN¥ 3,080.00 |
|
PH306127 | AK5 MS Standard C13 and N15-labeled recombinant protein (NP_036225) |
CN¥ 19,520.00 |
|
PH322241 | AK5 MS Standard C13 and N15-labeled recombinant protein (NP_777283) |
CN¥ 19,520.00 |
|
TP306127 | Recombinant protein of human adenylate kinase 5 (AK5), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
其它Adenylate kinase 5产品