Adenylate kinase 5 (AK5) (NM_012093) Human Mass Spec Standard
CAT#: PH306127
AK5 MS Standard C13 and N15-labeled recombinant protein (NP_036225)
View other "Adenylate kinase 5" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | AK5 MS Standard C13 and N15-labeled recombinant protein (NP_036225) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC206127 |
Predicted MW | 60.2 kDa |
Protein Sequence |
>RC206127 representing NM_012093
Red=Cloning site Green=Tags(s) MCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFVSQEKKTLPPLNGGQSRRSFLRNVMPGNSNFPYRRYD RLPPIHQFSIESDTDLSETAELIEEYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFQYISVGEL LRKKIHSTSSNRKWSLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICT PDLVVFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDADRDEDE VFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNVFGEDTMGGFMEDLRKC KIIFIIGGPGSGKGTQCEKLVEKYGFTHLSTGELLREELASESERSKLIRDIMERGDLVPSGIVLELLKE AMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDPQLVICMDCSADTMTNRLLQRSRSSLPVDDTTKTIAK RLEAYYRASIPVIAYYETKTQLHKINAEGTPEDVFLQLCTAIDSIF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036225 |
RefSeq Size | 3937 |
RefSeq ORF | 1608 |
Synonyms | AK6 |
Locus ID | 26289 |
Cytogenetics | 1p31.1 |
Summary | This gene encodes a member of the adenylate kinase family, which is involved in regulating the adenine nucleotide composition within a cell by catalyzing the reversible transfer of phosphate groups among adenine nucleotides. This member is related to the UMP/CMP kinase of several species. It is located in the cytosol and expressed exclusively in brain. Alternatively spliced transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403569 | AK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC415983 | AK5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403569 | Transient overexpression lysate of adenylate kinase 5 (AK5), transcript variant 1 |
CNY 3,080.00 |
|
LY415983 | Transient overexpression lysate of adenylate kinase 5 (AK5), transcript variant 2 |
CNY 3,080.00 |
|
PH322241 | AK5 MS Standard C13 and N15-labeled recombinant protein (NP_777283) |
CNY 19,520.00 |
|
TP306127 | Recombinant protein of human adenylate kinase 5 (AK5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP322241 | Recombinant protein of human adenylate kinase 5 (AK5), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Adenylate kinase 5产品