United States
Germany
Japan
United Kingdom
China
CD105 (ENG) (NM_000118) Human Recombinant Protein
CAT＃: TP321699
Recombinant protein of human endoglin (ENG), transcript variant 2, 20 µg
View other "CD105" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221699 representing NM_000118
Red=Cloning site Green=Tags(s) MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLE FPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPS FPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE GVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFK IFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTC SPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASM ISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQL DSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQ DQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTREYPRPPQSGP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 65 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_000109 |
| Locus ID | 2022 |
| UniProt ID | P17813 |
| Refseq Size | 3142 |
| Cytogenetics | 9q34.11 |
| Refseq ORF | 1884 |
| Synonyms | END; HHT1; ORW1 |
| Summary | This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. Mutations in this gene cause hereditary hemorrhagic telangiectasia, also known as Osler-Rendu-Weber syndrome 1, an autosomal dominant multisystemic vascular dysplasia. This gene may also be involved in preeclampsia and several types of cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2013] |
| Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC424919 | ENG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC426509 | ENG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY424919 | Transient overexpression lysate of endoglin (ENG), transcript variant 2 |
CNY 4,840.00 |
|
| LY426509 | Transient overexpression lysate of endoglin (ENG), transcript variant 1 |
CNY 3,080.00 |
|
| PH321699 | ENG MS Standard C13 and N15-labeled recombinant protein (NP_000109) |
CNY 19,520.00 |
|
| PH326069 | ENG MS Standard C13 and N15-labeled recombinant protein (NP_001108225) |
CNY 14,250.00 |
|
| TP326069 | Purified recombinant protein of Homo sapiens endoglin (ENG), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP721000 | Purified recombinant protein of Human endoglin (ENG), transcript variant 2 |
CNY 1,800.00 |
