LUC7L (NM_201412) Human Recombinant Protein
CAT#: TP321529
Recombinant protein of human LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2, 20 µg
View other "LUC7L" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221529 representing NM_201412
Red=Cloning site Green=Tags(s) MSAQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRAD YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKA EQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHF GGKLHLGFIQIREKLDQLRKTVAEKQEKRNQDRLRRREEREREERLSRRSGSRTRDRRRSRSRDRRRRRS RSTSRERRKLSRSRSRDRHRRHRSRSRSHSRGHRRASRDRSAKYKFSRERASREESWESGRSERGPPDWR LESSNGKMASRRSEEKEAGEI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 43.5 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_958815 |
Locus ID | 55692 |
UniProt ID | Q9NQ29 |
Refseq Size | 1452 |
Cytogenetics | 16p13.3 |
Refseq ORF | 1113 |
Synonyms | hLuc7B1; Luc7; LUC7B1; SR+89 |
Summary | The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403707 | LUC7L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413372 | LUC7L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429566 | LUC7L HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY403707 | Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 2 |
CNY 3,080.00 |
|
LY413372 | Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 1 |
CNY 3,080.00 |
|
LY429566 | Transient overexpression lysate of LUC7-like (S. cerevisiae) (LUC7L), transcript variant 1 |
CNY 3,080.00 |
|
PH321529 | LUC7L MS Standard C13 and N15-labeled recombinant protein (NP_958815) |
CNY 19,520.00 |