LUC7L Rabbit Polyclonal Antibody
CAT#: TA344588
Rabbit Polyclonal Anti-LUC7L Antibody - N-terminal region
Need it in bulk or conjugated?
Get a free quote
CN¥ 5,250.00
CN¥ 3,080.00
CN¥ 2,900.00
CN¥ 6,650.00
CN¥ 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LUC7L antibody: synthetic peptide directed towards the N terminal of human LUC7L. Synthetic peptide located within the following region: YEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVS |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 44 kDa |
Gene Name | LUC7 like |
Database Link | |
Background | The LUC7L gene may represent a mammalian heterochromatic gene, encoding a putative RNA-binding protein similar to the yeast Luc7p subunit of the U1 snRNP splicing complex that is normally required for 5-prime splice site selection (Tufarelli et al., 2001 [PubMed 11170747]). |
Synonyms | hLuc7B1; Luc7; LUC7B1; SR+89 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |