EMA (MUC1) (NM_001018016) Human Recombinant Protein
CAT#: TP321390
Recombinant protein of human mucin 1, cell surface associated (MUC1), transcript variant 2, 20 µg
View other "EMA" proteins (10)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 3 publications. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221390 protein sequence
Red=Cloning site Green=Tags(s) MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDP STDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASR YNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARD TYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.1 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | ELISA capture for autoantibodies (PMID: 26960182) |
Reference Data | |
RefSeq | NP_001018016 |
Locus ID | 4582 |
UniProt ID | P15941 |
Refseq Size | 1193 |
Cytogenetics | 1q22 |
Refseq ORF | 792 |
Synonyms | ADMCKD; ADMCKD1; ADTKD2; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM |
Summary | This gene encodes a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. This protein is expressed on the apical surface of epithelial cells that line the mucosal surfaces of many different tissues including lung, breast stomach and pancreas. This protein is proteolytically cleaved into alpha and beta subunits that form a heterodimeric complex. The N-terminal alpha subunit functions in cell-adhesion and the C-terminal beta subunit is involved in cell signaling. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is known to contain a highly polymorphic variable number tandem repeats (VNTR) domain. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2011] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Citations (3)
The use of this Proteins has been cited in the following citations: |
---|
A large-area organic transistor with 3D-printed sensing gate for noninvasive single-molecule detection of pancreatic mucinous cyst markers
,null,
Analytical and Bioanalytical Chemistry
,PubMed ID 35410389
[MUC1]
|
Single‐Molecule Bioelectronic Label‐Free Assay of both Protein and Genomic Markers of Pancreatic Mucinous Cysts’ in Whole Blood Serum
,Macchia, E;Sarcina, L;Driescher, C;Gounani, Z;Tewari, A;Osterbacka, R;Palazzo, G;Tricase, A;Kovacs Vajna, Z;Viola, F;Modena, F;Caironi, M;Torricelli, F;Esposito, I;Torsi, L;,
Advanced Electronic Materials
[MUC1]
|
Enhanced binding of antibodies generated during chronic HIV infection to mucus component MUC16
,Gunn, BM;Schneider, JR;Shansab, M;Bastian, AR;Fahrbach, KM;Smith, AD;Mahan, AE;Karim, MM;Licht, AF;Zvonar, I;Tedesco, J;Anderson, MR;Chapel, A;Suscovich, TJ;Malaspina, DC;Streeck, H;Walker, BD;Kim, A;Lauer, G;Altfeld, M;Pillai, S;Szleifer, I;Kelleher, NL;Kiser, PF;Hope, TJ;Alter, G;,
Mucosal Immunol
,PubMed ID 26960182
[MUC1]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400880 | MUC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420828 | MUC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422694 | MUC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422695 | MUC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400880 | Transient overexpression lysate of mucin 1, cell surface associated (MUC1), transcript variant 1 |
CNY 3,080.00 |
|
LY420828 | Transient overexpression lysate of mucin 1, cell surface associated (MUC1), transcript variant 6 |
CNY 3,080.00 |
|
LY422694 | Transient overexpression lysate of mucin 1, cell surface associated (MUC1), transcript variant 2 |
CNY 3,080.00 |
|
LY422695 | Transient overexpression lysate of mucin 1, cell surface associated (MUC1), transcript variant 3 |
CNY 3,080.00 |
|
PH321390 | MUC1 MS Standard C13 and N15-labeled recombinant protein (NP_001018016) |
CNY 19,520.00 |
|
TP760771 | Purified recombinant protein of Human mucin 1, cell surface associated (MUC1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |