United States
Germany
Japan
United Kingdom
China
EMA (MUC1) (NM_001018016) Human Mass Spec Standard
CAT＃: PH321390
MUC1 MS Standard C13 and N15-labeled recombinant protein (NP_001018016)
View other "EMA" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
| Product Data | |
| Description | MUC1 MS Standard C13 and N15-labeled recombinant protein (NP_001018016) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221390 |
| Predicted MW | 28.4 kDa |
| Protein Sequence |
>RC221390 protein sequence
Red=Cloning site Green=Tags(s) MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEKNAFNSSLEDP STDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDVETQFNQYKTEAASR YNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLVALAIVYLIALAVCQCRRKNYGQLDIFPARD TYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001018016 |
| RefSeq Size | 1193 |
| RefSeq ORF | 792 |
| Synonyms | ADMCKD; ADMCKD1; ADTKD2; CA 15-3; CD227; EMA; H23AG; KL-6; MAM6; MCD; MCKD; MCKD1; MUC-1; MUC-1/SEC; MUC-1/X; MUC1/ZD; PEM; PEMT; PUM |
| Locus ID | 4582 |
| Cytogenetics | 1q22 |
| Summary | This gene encodes a membrane-bound protein that is a member of the mucin family. Mucins are O-glycosylated proteins that play an essential role in forming protective mucous barriers on epithelial surfaces. These proteins also play a role in intracellular signaling. This protein is expressed on the apical surface of epithelial cells that line the mucosal surfaces of many different tissues including lung, breast stomach and pancreas. This protein is proteolytically cleaved into alpha and beta subunits that form a heterodimeric complex. The N-terminal alpha subunit functions in cell-adhesion and the C-terminal beta subunit is involved in cell signaling. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas. This gene is known to contain a highly polymorphic variable number tandem repeats (VNTR) domain. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Feb 2011] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400880 | MUC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420828 | MUC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422694 | MUC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422695 | MUC1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400880 | Transient overexpression lysate of mucin 1, cell surface associated (MUC1), transcript variant 1 |
CNY 3,080.00 |
|
| LY420828 | Transient overexpression lysate of mucin 1, cell surface associated (MUC1), transcript variant 6 |
CNY 3,080.00 |
|
| LY422694 | Transient overexpression lysate of mucin 1, cell surface associated (MUC1), transcript variant 2 |
CNY 3,080.00 |
|
| LY422695 | Transient overexpression lysate of mucin 1, cell surface associated (MUC1), transcript variant 3 |
CNY 3,080.00 |
|
| TP321390 | Recombinant protein of human mucin 1, cell surface associated (MUC1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP760771 | Purified recombinant protein of Human mucin 1, cell surface associated (MUC1), transcript variant 3, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
