United States
Germany
Japan
United Kingdom
China
SH3BP5 (NM_001018009) Human Recombinant Protein
CAT＃: TP321321
Recombinant protein of human SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 2, 20 µg
View other "SH3BP5" proteins (8)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC221321 protein sequence
Red=Cloning site Green=Tags(s) MDAALKRSRSEEPAEILPPARDEEEEEEEGMEQGLEEEEEVDPRIQGELEKLNQSTDDINRRETELEDAR QKFRSVLVEATVKLDELVKKIGKAVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAE QRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKP YFELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSST SVEDLPGSKPEPDAISVASEAFEDDSCSNFVSEDDSETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLP SPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRGLSSSSGSGGSSKSQSST SPEGQALENRMKQLSLQCSKGRDGIIADIKMVQIG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 32 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001018009 |
| Locus ID | 9467 |
| UniProt ID | O60239 |
| Refseq Size | 3203 |
| Cytogenetics | 3p25.1 |
| Refseq ORF | 1365 |
| Synonyms | SAB; SH3BP-5 |
| Summary | Functions as guanine nucleotide exchange factor (GEF) with specificity for RAB11A and RAB25 (PubMed:26506309, PubMed:30217979). Inhibits the auto- and transphosphorylation activity of BTK. Plays a negative regulatory role in BTK-related cytoplasmic signaling in B-cells. May be involved in BCR-induced apoptotic cell death.[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417710 | SH3BP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422692 | SH3BP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417710 | Transient overexpression lysate of SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 1 |
CNY 3,080.00 |
|
| LY422692 | Transient overexpression lysate of SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 2 |
CNY 3,080.00 |
|
| PH303999 | SH3BP5 MS Standard C13 and N15-labeled recombinant protein (NP_004835) |
CNY 19,520.00 |
|
| PH321321 | SH3BP5 MS Standard C13 and N15-labeled recombinant protein (NP_001018009) |
CNY 19,520.00 |
|
| TP303999 | Recombinant protein of human SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP710151 | Recombinant protein of human SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |
