SH3BP5 (NM_004844) Human Mass Spec Standard
CAT#: PH303999
SH3BP5 MS Standard C13 and N15-labeled recombinant protein (NP_004835)
View other "SH3BP5" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SH3BP5 MS Standard C13 and N15-labeled recombinant protein (NP_004835) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC203999 |
Predicted MW | 50.4 kDa |
Protein Sequence |
>RC203999 protein sequence
Red=Cloning site Green=Tags(s) MDAALKRSRSEEPAEILPPARDEEEEEEEGMEQGLEEEEEVDPRIQGELEKLNQSTDDINRRETELEDAR QKFRSVLVEATVKLDELVKKIGKAVEDSKPYWEARRVARQAQLEAQKATQDFQRATEVLRAAKETISLAE QRLLEDDKRQFDSAWQEMLNHATQRVMEAEQTKTRSELVHKETAARYNAAMGRMRQLEKKLKRAINKSKP YFELKAKYYVQLEQLKKTVDDLQAKLTLAKGEYKMALKNLEMISDEIHERRRSSAMGPRGCGVGAEGSST SVEDLPGSKPEPDAISVASEAFEDDSCSNFVSEDDSETQSVSSFSSGPTSPSEMPDQFPAVVRPGSLDLP SPVSLSEFGMMFPVLGPRSECSGASSPECEVERGDRAEGAENKTSDKANNNRGLSSSSGSGGSSKSQSST SPEGQALENRMKQLSLQCSKGRDGIIADIKMVQIG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004835 |
RefSeq Size | 3322 |
RefSeq ORF | 1365 |
Synonyms | SAB; SH3BP-5 |
Locus ID | 9467 |
Cytogenetics | 3p25.1 |
Summary | Functions as guanine nucleotide exchange factor (GEF) with specificity for RAB11A and RAB25 (PubMed:26506309, PubMed:30217979). Inhibits the auto- and transphosphorylation activity of BTK. Plays a negative regulatory role in BTK-related cytoplasmic signaling in B-cells. May be involved in BCR-induced apoptotic cell death.[UniProtKB/Swiss-Prot Function] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417710 | SH3BP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422692 | SH3BP5 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417710 | Transient overexpression lysate of SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 1 |
CNY 3,080.00 |
|
LY422692 | Transient overexpression lysate of SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 2 |
CNY 3,080.00 |
|
PH321321 | SH3BP5 MS Standard C13 and N15-labeled recombinant protein (NP_001018009) |
CNY 19,520.00 |
|
TP303999 | Recombinant protein of human SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP321321 | Recombinant protein of human SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP710151 | Recombinant protein of human SH3-domain binding protein 5 (BTK-associated) (SH3BP5), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug |
CNY 4,020.00 |