CCT3 (NM_005998) Human Recombinant Protein
CAT#: TP321229
Recombinant protein of human chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 1, 20 µg
View other "CCT3" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC221229 representing NM_005998
Red=Cloning site Green=Tags(s) MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREI QVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKI SIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIE DSCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCE DIIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLL EIKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDM KELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005989 |
Locus ID | 7203 |
UniProt ID | P49368 |
Refseq Size | 2096 |
Cytogenetics | 1q22 |
Refseq ORF | 1635 |
Synonyms | CCT-gamma; CCTG; PIG48; TCP-1-gamma; TRIC5 |
Summary | The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8. [provided by RefSeq, Aug 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416943 | CCT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423380 | CCT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY416943 | Transient overexpression lysate of chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 1 |
CNY 3,080.00 |
|
LY423380 | Transient overexpression lysate of chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 3 |
CNY 4,840.00 |
|
PH321229 | CCT3 MS Standard C13 and N15-labeled recombinant protein (NP_005989) |
CNY 19,520.00 |
|
TP303580 | Purified recombinant protein of Human chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 2, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug |
CNY 2,900.00 |