CCT3 (NM_001008883) Human Recombinant Protein
CAT#: TP303580
Purified recombinant protein of Human chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 2, full length, with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
View other "CCT3" proteins (6)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC203580 representing NM_001008883
Red=Cloning site Green=Tags(s) MGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMTNDGNAILREIQ VQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPTVVISAYRKALDDMISTLKKIS IPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAVKMVQFEENGRKEIDIKKYARVEKIPGGIIED SCVLRGVMINKDVTHPRMRRYIKNPRIVLLDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCED IIQLKPDVVITEKGISDLAQHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLE IKKIGDEYFTFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAHA LTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGVNGETGTLVDMK ELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAPDAGQE myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.3 kDa |
Concentration | >50 ug/mL as determined by microplate Bradford method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25mM Tris-HCl, pH7.3, 100mM glycine, 10% glycerol |
Storage | Store at -80°C after receiving vials. |
Stability | Stable for at least 1 year from receipt of products under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001008883 |
Locus ID | 7203 |
UniProt ID | P49368 |
Refseq Size | 2093 |
Cytogenetics | 1q22 |
Refseq ORF | 1635 |
Synonyms | CCT-gamma; CCTG; PIG48; TCP-1-gamma; TRIC5 |
Summary | The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8. [provided by RefSeq, Aug 2010] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416943 | CCT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC423380 | CCT3 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY416943 | Transient overexpression lysate of chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 1 |
CN¥ 3,080.00 |
|
LY423380 | Transient overexpression lysate of chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 3 |
CN¥ 4,840.00 |
|
PH321229 | CCT3 MS Standard C13 and N15-labeled recombinant protein (NP_005989) |
CN¥ 19,520.00 |
|
TP321229 | Recombinant protein of human chaperonin containing TCP1, subunit 3 (gamma) (CCT3), transcript variant 1, 20 µg |
CN¥ 2,900.00 |