NF-kB p65 (RELA) (NM_021975) Human Recombinant Protein
CAT#: TP320780
Recombinant protein of human v-rel reticuloendotheliosis viral oncogene homolog A (avian) (RELA), transcript variant 1, 20 µg
View other "NF-kB p65" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
Cited in 9 publications. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220780 representing NM_021975
Red=Cloning site Green=Tags(s) MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPG TVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNP FQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGD EIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDREL SEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYP FTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTE PMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60 kDa |
Concentration | >0.1 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | RELA Activity Verified in a DNA-binding Assay: RELA activity was measured in a colorimetric DNA-binding assay. Double-stranded oligonucleotide containing the RELA consensus DNA-binding sequence was incubated with dilutions of the purified RELA protein. RELA bound to the oligo was captured onto the surface of a microtiter plate and after washing, bound RELA was detected with an anti-RELA primary antibody followed by an HRP-labeled secondary antibody. After initial color development, the reaction was quenched and the color intensity was measured at 450nm. ELISA binding assay (PMID: 25584020) WB positive control (PMID: 25853889) EMSA assay (PMID: 25853889) Binding assay (PMID: 26561547) Pull-down assay (PMID: 26984196) |
Reference Data | |
RefSeq | NP_068810 |
Locus ID | 5970 |
UniProt ID | Q04206 |
Refseq Size | 1760 |
Cytogenetics | 11q13.1 |
Refseq ORF | 1653 |
Synonyms | CMCU; NFKB3; p65 |
Summary | NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Prostate cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, T cell receptor signaling pathway, Toll-like receptor signaling pathway |
Citations (9)
The use of this Proteins has been cited in the following citations: |
---|
Highly efficient expression of circular RNA aptamers in cells using autocatalytic transcripts
,Litke, JL;Jaffrey, SR;,
Nat. Biotechnol.
,PubMed ID 30962542
[RELA]
|
Detecting transcription factors with allosteric DNA-Silver nanocluster switches
,Li, B;Chen, Y;Wang, J;Lu, Q;Zhu, W;Luo, J;Hong, J;Zhou, X;,
Analytica Chimica Acta
[RELA]
|
Novel Nuclear Factor-KappaB Targeting Peptide Suppresses β-Amyloid Induced Inflammatory and Apoptotic Responses in Neuronal Cells
,null,
PLoS ONE
,PubMed ID 27764084
[RELA]
|
The M. tuberculosis HAD phosphatase (Rv3042c) interacts with host proteins and is inhibited by Clofazimine
,Shree, S;Singh, AK;Saxena, R;Kumar, H;,
Cellular and Molecular Life Sciences
,PubMed ID 26984196
[RELA]
|
FOXO3-NF-?B RelA Protein Complexes Reduce Proinflammatory Cell Signaling and Function
,Thompson, MG;Larson, M;Vidrine, A;Barrios, K;Navarro, F;Meyers, K;Simms, P;Prajapati, K;Chitsike, L;Hellman, LM;Baker, BM;Watkins, SK;,
J. Immunol.
,PubMed ID 26561547
[RELA]
|
MYB Elongation Is Regulated by the Nucleic Acid Binding of NF?B p50 to the Intronic Stem-Loop Region
,Pereira, LA;Hugo, HJ;Malaterre, J;Huiling, X;Sonza, S;Cures, A;Purcell, DF;Ramsland, PA;Gerondakis, S;Gonda, TJ;Ramsay, RG;,
PLoS ONE
,PubMed ID 25853889
[RELA]
|
Functional characterization of a competitive peptide antagonist of p65 in human macrophage-like cells suggests therapeutic potential for chronic inflammation
,Srinivasan, M;Blackburn, C;Lahiri, D;,
Drug Design, Development and Therapy
,PubMed ID 25584020
[RELA]
|
Novel p65 Binding Glucocorticoid-induced Leucine Zipper Peptide Suppresses Experimental Autoimmune Encephalomyelitis
,Mythily Srinivasan and Srihari Janardhanam,
J. Biol. Chem., Dec 2011; 286: 44799 - 44810.
[RELA]
|
Novel p65 Binding Glucocorticoid-induced Leucine Zipper Peptide Suppresses Experimental Autoimmune Encephalomyelitis
,null,
The Journal of Biological Chemistry
,PubMed ID 21965677
[RELA]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402895 | RELA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402895 | Transient overexpression lysate of v-rel reticuloendotheliosis viral oncogene homolog A (avian) (RELA), transcript variant 1 |
CNY 4,840.00 |
|
PH320780 | RELA MS Standard C13 and N15-labeled recombinant protein (NP_068810) |
CNY 19,520.00 |
|
TP750174 | Purified recombinant protein of Human v-rel reticuloendotheliosis viral oncogene homolog A (avian) (p65), transcript variant 1, Ser374-end, with C-terminal Myc-DDK tag, expressed in E.coli, 50ug |
CNY 1,948.00 |
其它NF-kB p65产品