NF-kB p65 (RELA) (NM_021975) Human Mass Spec Standard
CAT#: PH320780
RELA MS Standard C13 and N15-labeled recombinant protein (NP_068810)
View other "NF-kB p65" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RELA MS Standard C13 and N15-labeled recombinant protein (NP_068810) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220780 |
Predicted MW | 60 kDa |
Protein Sequence |
>RC220780 representing NM_021975
Red=Cloning site Green=Tags(s) MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPG TVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNP FQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGD EIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRVSMQLRRPSDREL SEPMEFQYLPDTDDRHRIEEKRKRTYETFKSIMKKSPFSGPTDPRPPPRRIAVPSRSSASVPKPAPQPYP FTSSLSTINYDEFPTMVFPSGQISQASALAPAPPQVLPQAPAPAPAPAMVSALAQAPAPVPVLAPGPPQA VAPPAPKPTQAGEGTLSEALLQLQFDDEDLGALLGNSTDPAVFTDLASVDNSEFQQLLNQGIPVAPHTTE PMLMEYPEAITRLVTGAQRPPDPAPAPLGAPGLPNGLLSGDEDFSSIADMDFSALLSQISS myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_068810 |
RefSeq Size | 1760 |
RefSeq ORF | 1653 |
Synonyms | CMCU; NFKB3; p65 |
Locus ID | 5970 |
Cytogenetics | 11q13.1 |
Summary | NF-kappa-B is a ubiquitous transcription factor involved in several biological processes. It is held in the cytoplasm in an inactive state by specific inhibitors. Upon degradation of the inhibitor, NF-kappa-B moves to the nucleus and activates transcription of specific genes. NF-kappa-B is composed of NFKB1 or NFKB2 bound to either REL, RELA, or RELB. The most abundant form of NF-kappa-B is NFKB1 complexed with the product of this gene, RELA. Four transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Prostate cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, T cell receptor signaling pathway, Toll-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402895 | RELA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402895 | Transient overexpression lysate of v-rel reticuloendotheliosis viral oncogene homolog A (avian) (RELA), transcript variant 1 |
CNY 4,840.00 |
|
TP320780 | Recombinant protein of human v-rel reticuloendotheliosis viral oncogene homolog A (avian) (RELA), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP750174 | Purified recombinant protein of Human v-rel reticuloendotheliosis viral oncogene homolog A (avian) (p65), transcript variant 1, Ser374-end, with C-terminal Myc-DDK tag, expressed in E.coli, 50ug |
CNY 1,948.00 |
其它NF-kB p65产品