Integrin Linked Kinase (ILK) (NM_001014794) Human Recombinant Protein
CAT#: TP320460
Recombinant protein of human integrin-linked kinase (ILK), transcript variant 2, 20 µg
View other "Integrin Linked Kinase" proteins (8)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC220460 protein sequence
Red=Cloning site Green=Tags(s) MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTP LHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKA KAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKG RWQGNDIVVKVLKVRDWSTRKSRDFNEECPRLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNV LHEGTNFVVDQSQAVKFALDMARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRM YAPAWVAPEALQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 51.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001014794 |
Locus ID | 3611 |
UniProt ID | Q13418, V9HWF0 |
Refseq Size | 1797 |
Cytogenetics | 11p15.4 |
Refseq ORF | 1356 |
Synonyms | HEL-S-28; ILK-1; ILK-2; P59; p59ILK |
Summary | This gene encodes a protein with a kinase-like domain and four ankyrin-like repeats. The encoded protein associates at the cell membrane with the cytoplasmic domain of beta integrins, where it regulates integrin-mediated signal transduction. Activity of this protein is important in the epithelial to mesenchymal transition, and over-expression of this gene is implicated in tumor growth and metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | Endometrial cancer, Focal adhesion, PPAR signaling pathway |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Stabilization of integrin-linked kinase by the Hsp90-CHIP axis impacts cellular force generation, migration and the fibrotic response
,Korana Radovanac, Jessica Morgner, Jan-Niklas Schulz, Katrin Blumbach, Cam Patterson, + et al.,
The EMBO Journal 32, 1409-1424 doi:10.1038/emboj.2013.90
,PubMed ID 23612611
[ILK]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401438 | ILK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC423078 | ILK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC423079 | ILK HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY401438 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 1 |
CNY 3,080.00 |
|
LY423078 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 2 |
CNY 4,840.00 |
|
LY423079 | Transient overexpression lysate of integrin-linked kinase (ILK), transcript variant 3 |
CNY 4,840.00 |
|
PH320460 | ILK MS Standard C13 and N15-labeled recombinant protein (NP_001014794) |
CNY 19,520.00 |
|
TP760620 | Purified recombinant protein of Human integrin-linked kinase (ILK), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它Integrin Linked Kinase产品