United States
Germany
Japan
United Kingdom
China
PSMA4 (NM_001102667) Human Recombinant Protein
CAT＃: TP320385
Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2, 20 µg
View other "PSMA4" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC220385 protein sequence
Red=Cloning site Green=Tags(s) MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNE DMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWD KHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEK VEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 29.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001096137 |
| Locus ID | 5685 |
| UniProt ID | P25789 |
| Refseq Size | 1159 |
| Cytogenetics | 15q25.1 |
| Refseq ORF | 783 |
| Synonyms | HC9; HsT17706; PSC9 |
| Summary | This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq, Aug 2016] |
| Protein Families | Druggable Genome, Protease |
| Protein Pathways | Proteasome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419117 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420186 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420187 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY419117 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1 |
CNY 3,080.00 |
|
| LY420186 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2 |
CNY 3,080.00 |
|
| LY420187 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 3 |
CNY 3,080.00 |
|
| PH302786 | PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_002780) |
CNY 19,520.00 |
|
| PH320385 | PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_001096137) |
CNY 19,520.00 |
|
| TP302786 | Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1, 20 µg |
CNY 2,900.00 |
