PSMA4 (NM_002789) Human Mass Spec Standard
CAT#: PH302786
PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_002780)
View other "PSMA4" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_002780) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC202786 |
Predicted MW | 29.5 kDa |
Protein Sequence |
>RC202786 protein sequence
Red=Cloning site Green=Tags(s) MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVFFSEKIYKLNE DMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQAYTQFGGKRPFGVSLLYIGWD KHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYKEGEMTLKSALALAIKVLNKTMDVSKLSAEK VEIATLTRENGKTVIRVLKQKEVEQLIKKHEEEEAKAEREKKEKEQKEKDK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002780 |
RefSeq Size | 1235 |
RefSeq ORF | 783 |
Synonyms | HC9; HsT17706; PSC9 |
Locus ID | 5685 |
Cytogenetics | 15q25.1 |
Summary | This gene encodes a core alpha subunit of the 20S proteosome, which is a highly ordered ring-shaped structure composed of four rings of 28 non-identical subunits. Proteasomes cleave peptides in an ATP- and ubiquitin-dependent manner. [provided by RefSeq, Aug 2016] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Proteasome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419117 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420186 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC420187 | PSMA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY419117 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1 |
CNY 3,080.00 |
|
LY420186 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2 |
CNY 3,080.00 |
|
LY420187 | Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 3 |
CNY 3,080.00 |
|
PH320385 | PSMA4 MS Standard C13 and N15-labeled recombinant protein (NP_001096137) |
CNY 19,520.00 |
|
TP302786 | Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP320385 | Recombinant protein of human proteasome (prosome, macropain) subunit, alpha type, 4 (PSMA4), transcript variant 2, 20 µg |
CNY 2,900.00 |