GnRH (GNRH1) (NM_001083111) Human Recombinant Protein
CAT#: TP319734
Recombinant protein of human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2, 20 µg
View other "GnRH" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219734 protein sequence
Red=Cloning site Green=Tags(s) MKPIQKLLAGLILLTWCVEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLAETQRFECTTHQPRS PLRDLKGALESLIEEETGQKKI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 7.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001076580 |
Locus ID | 2796 |
UniProt ID | P01148 |
Refseq Size | 1297 |
Cytogenetics | 8p21.2 |
Refseq ORF | 276 |
Synonyms | GNRH; GRH; LHRH; LNRH |
Summary | This gene encodes a preproprotein that is proteolytically processed to generate a peptide that is a member of the gonadotropin-releasing hormone (GnRH) family of peptides. Alternative splicing results in multiple transcript variants, at least one of which is secreted and then cleaved to generate gonadoliberin-1 and GnRH-associated peptide 1. Gonadoliberin-1 stimulates the release of luteinizing and follicle stimulating hormones, which are important for reproduction. Mutations in this gene are associated with hypogonadotropic hypogonadism. [provided by RefSeq, Nov 2015] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | GnRH signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC421206 | GNRH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424503 | GNRH1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY421206 | Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 2 |
CNY 3,080.00 |
|
LY424503 | Transient overexpression lysate of gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1 |
CNY 3,080.00 |
|
PH312991 | GNRH1 MS Standard C13 and N15-labeled recombinant protein (NP_000816) |
CNY 19,520.00 |
|
PH319734 | GNRH1 MS Standard C13 and N15-labeled recombinant protein (NP_001076580) |
CNY 19,520.00 |
|
TP312991 | Recombinant protein of human gonadotropin-releasing hormone 1 (luteinizing-releasing hormone) (GNRH1), transcript variant 1, 20 µg |
CNY 2,900.00 |