Macrophage inflammatory protein 5 (CCL15) (NM_004167) Human Recombinant Protein
CAT#: TP319289
Recombinant protein of human chemokine (C-C motif) ligand 15 (CCL15), transcript variant 2, 20 µg
View other "Macrophage inflammatory protein 5" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219289 representing NM_004167
Red=Cloning site Green=Tags(s) MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 10.1 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004158 |
Locus ID | 6359 |
UniProt ID | Q16663 |
Refseq Size | 1392 |
Cytogenetics | 17q12 |
Refseq ORF | 339 |
Synonyms | HCC-2; HMRP-2B; Lkn-1; LKN1; MIP-1d; MIP-5; NCC-3; NCC3; SCYA15; SCYL3; SY15 |
Summary | This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14). [provided by RefSeq, Jan 2013] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409848 | CCL15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC409849 | CCL15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC418174 | CCL15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY409848 | Transient overexpression lysate of chemokine (C-C motif) ligand 15 (CCL15), transcript variant 1 |
CNY 3,080.00 |
|
LY409849 | Transient overexpression lysate of chemokine (C-C motif) ligand 15 (CCL15) |
CNY 3,080.00 |
|
LY418174 | Transient overexpression lysate of chemokine (C-C motif) ligand 15 (CCL15), transcript variant 2 |
CNY 3,080.00 |
|
PH312975 | CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_116740) |
CNY 19,520.00 |
|
PH319289 | CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_004158) |
CNY 19,520.00 |
|
TP312975 | Recombinant protein of human chemokine (C-C motif) ligand 15 (CCL15), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Macrophage inflammatory protein 5产品