United States
Germany
Japan
United Kingdom
China
Macrophage inflammatory protein 5 (CCL15) (NM_004167) Human Mass Spec Standard
CAT＃: PH319289
CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_004158)
View other "Macrophage inflammatory protein 5" proteins (9)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_004158) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC219289 |
| Predicted MW | 12.24 kDa |
| Protein Sequence |
>RC219289 representing NM_004167
Red=Cloning site Green=Tags(s) MKVSVAALSCLMLVAVLGSQAQFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004158 |
| RefSeq Size | 1392 |
| RefSeq ORF | 339 |
| Synonyms | HCC-2; HMRP-2B; Lkn-1; LKN1; MIP-1d; MIP-5; NCC-3; NCC3; SCYA15; SCYL3; SY15 |
| Locus ID | 6359 |
| Cytogenetics | 17q12 |
| Summary | This gene is located in a cluster of similar genes in the same region of chromosome 17. These genes encode CC cytokines, which are secreted proteins characterized by two adjacent cysteines. The product of this gene is chemotactic for T cells and monocytes, and acts through C-C chemokine receptor type 1 (CCR1). The proprotein is further processed into numerous smaller functional peptides. Naturally-occurring readthrough transcripts occur from this gene into the downstream gene, CCL14 (chemokine (C-C motif) ligand 14). [provided by RefSeq, Jan 2013] |
| Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
| Protein Pathways | Chemokine signaling pathway, Cytokine-cytokine receptor interaction |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409848 | CCL15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409849 | CCL15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC418174 | CCL15 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY409848 | Transient overexpression lysate of chemokine (C-C motif) ligand 15 (CCL15), transcript variant 1 |
CNY 3,080.00 |
|
| LY409849 | Transient overexpression lysate of chemokine (C-C motif) ligand 15 (CCL15) |
CNY 3,080.00 |
|
| LY418174 | Transient overexpression lysate of chemokine (C-C motif) ligand 15 (CCL15), transcript variant 2 |
CNY 3,080.00 |
|
| PH312975 | CCL15 MS Standard C13 and N15-labeled recombinant protein (NP_116740) |
CNY 19,520.00 |
|
| TP312975 | Recombinant protein of human chemokine (C-C motif) ligand 15 (CCL15), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP319289 | Recombinant protein of human chemokine (C-C motif) ligand 15 (CCL15), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Macrophage inflammatory protein 5产品
