MEST (NM_177525) Human Recombinant Protein
CAT#: TP319273
Recombinant protein of human mesoderm specific transcript homolog (mouse) (MEST), transcript variant 3, 20 µg
View other "MEST" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219273 representing NM_177525
Red=Cloning site Green=Tags(s) MREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQDSVGVVGSPEIVVLLHGFP TSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSIFEQASIVEALLRHLGLQNRRINLLSHDYG DIVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTP VFGPYTRPSESELWDMWAGIRNNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPY PEFLELYRKTLPRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_803491 |
Locus ID | 4232 |
UniProt ID | Q5EB52 |
Refseq Size | 2419 |
Cytogenetics | 7q32.2 |
Refseq ORF | 978 |
Synonyms | PEG1 |
Summary | This gene encodes a member of the alpha/beta hydrolase superfamily. It is imprinted, exhibiting preferential expression from the paternal allele in fetal tissues, and isoform-specific imprinting in lymphocytes. The loss of imprinting of this gene has been linked to certain types of cancer and may be due to promotor switching. The encoded protein may play a role in development. Alternatively spliced transcript variants encoding multiple isoforms have been identified for this gene. Pseudogenes of this gene are located on the short arm of chromosomes 3 and 4, and the long arm of chromosomes 6 and 15. [provided by RefSeq, Dec 2011] |
Protein Families | Protease, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406095 | MEST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419353 | MEST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406095 | Transient overexpression lysate of mesoderm specific transcript homolog (mouse) (MEST), transcript variant 3 |
CNY 3,080.00 |
|
LY419353 | Transient overexpression lysate of mesoderm specific transcript homolog (mouse) (MEST), transcript variant 1 |
CNY 3,080.00 |
|
PH319273 | MEST MS Standard C13 and N15-labeled recombinant protein (NP_803491) |
CNY 19,520.00 |
|
TP762067 | Purified recombinant protein of Human mesoderm specific transcript homolog (mouse) (MEST), transcript variant 1,Tyr83-Val266, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2,050.00 |
|
TP762538 | Purified recombinant protein of Human mesoderm specific transcript homolog (mouse) (MEST), transcript variant 1, 50ug |
CNY 2,480.00 |