MEST (NM_177525) Human Mass Spec Standard
CAT#: PH319273
MEST MS Standard C13 and N15-labeled recombinant protein (NP_803491)
View other "MEST" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | MEST MS Standard C13 and N15-labeled recombinant protein (NP_803491) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC219273 |
Predicted MW | 37.4 kDa |
Protein Sequence |
>RC219273 representing NM_177525
Red=Cloning site Green=Tags(s) MREWWVQVGLLAVPLLAAYLHIPPPQLSPALHSWKSSGKFFTYKGLRIFYQDSVGVVGSPEIVVLLHGFP TSSYDWYKIWEGLTLRFHRVIALDFLGFGFSDKPRPHHYSIFEQASIVEALLRHLGLQNRRINLLSHDYG DIVAQELLYRYKQNRSGRLTIKSLCLSNGGIFPETHRPLLLQKLLKDGGVLSPILTRLMNFFVFSRGLTP VFGPYTRPSESELWDMWAGIRNNDGNLVIDSLLQYINQRKKFRRRWVGALASVTIPIHFIYGPLDPVNPY PEFLELYRKTLPRSTVSILDDHISHYPQLEDPMGFLNAYMGFINSF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_803491 |
RefSeq Size | 2419 |
RefSeq ORF | 978 |
Synonyms | PEG1 |
Locus ID | 4232 |
Cytogenetics | 7q32.2 |
Summary | This gene encodes a member of the alpha/beta hydrolase superfamily. It is imprinted, exhibiting preferential expression from the paternal allele in fetal tissues, and isoform-specific imprinting in lymphocytes. The loss of imprinting of this gene has been linked to certain types of cancer and may be due to promotor switching. The encoded protein may play a role in development. Alternatively spliced transcript variants encoding multiple isoforms have been identified for this gene. Pseudogenes of this gene are located on the short arm of chromosomes 3 and 4, and the long arm of chromosomes 6 and 15. [provided by RefSeq, Dec 2011] |
Protein Families | Protease, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406095 | MEST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419353 | MEST HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY406095 | Transient overexpression lysate of mesoderm specific transcript homolog (mouse) (MEST), transcript variant 3 |
CNY 3,080.00 |
|
LY419353 | Transient overexpression lysate of mesoderm specific transcript homolog (mouse) (MEST), transcript variant 1 |
CNY 3,080.00 |
|
TP319273 | Recombinant protein of human mesoderm specific transcript homolog (mouse) (MEST), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP762067 | Purified recombinant protein of Human mesoderm specific transcript homolog (mouse) (MEST), transcript variant 1,Tyr83-Val266, with N-terminal His tag, expressed in E. coli, 50ug |
CNY 2,050.00 |
|
TP762538 | Purified recombinant protein of Human mesoderm specific transcript homolog (mouse) (MEST), transcript variant 1, 50ug |
CNY 2,480.00 |