IKK beta (IKBKB) (NM_001556) Human Recombinant Protein
CAT#: TP319154
Recombinant protein of human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta (IKBKB), 20 µg
View other "IKK beta" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 6,281.00
CNY 600.00
CNY 1,050.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC219154 representing NM_001556
Red=Cloning site Green=Tags(s) MSWSPSLTTQTCGAWEMKERLGTGGFGNVIRWHNQETGEQIAIKQCRQELSPRNRERWCLEIQIMRRLTH PNVVAARDVPEGMQNLAPNDLPLLAMEYCQGGDLRKYLNQFENCCGLREGAILTLLSDIASALRYLHENR IIHRDLKPENIVLQQGEQRLIHKIIDLGYAKELDQGSLCTSFVGTLQYLAPELLEQQKYTVTVDYWSFGT LAFECITGFRPFLPNWQPVQWHSKVRQKSEVDIVVSEDLNGTVKFSSSLPYPNNLNSVLAERLEKWLQLM LMWHPRQRGTDPTYGPNGCFKALDDILNLKLVHILNMVTGTIHTYPVTEDESLQSLKARIQQDTGIPEED QELLQEAGLALIPDKPATQCISDGKLNEGHTLDMDLVFLFDNSKITYETQISPRPQPESVSCILQEPKRN LAFFQLRKVWGQVWHSIQTLKEDCNRLQQGQRAAMMNLLRNNSCLSKMKNSMASMSQQLKAKLDFFKTSI QIDLEKYSEQTEFGITSDKLLLAWREMEQAVELCGRENEVKLLVERMMALQTDIVDLQRSPMGRKQGGTL DDLEEQARELYRRLREKPRDQRTEGDSQEMVRLLLQAIQSFEKKVRVIYTQLSKTVVCKQKALELLPKVE EVVSLMNEDEKTVVRLQEKRQKELWNLLKIACSKVRGPVSGSPDSMNASRLSQPGQLMSQPSTASNSLPE PAKKSEELVAEAHNLCTLLENAIQDTVREQDQSFTALDWSWLQTEEEEHSCLEQAS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 86.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | Binding assay (PMID: 29889904) |
Reference Data | |
RefSeq | NP_001547 |
Locus ID | 3551 |
UniProt ID | O14920 |
Refseq Size | 3916 |
Cytogenetics | 8p11.21 |
Refseq ORF | 2268 |
Synonyms | IKK-beta; IKK2; IKKB; IMD15; IMD15A; IMD15B; NFKBIKB |
Summary | The protein encoded by this gene phosphorylates the inhibitor in the inhibitor/NF-kappa-B complex, causing dissociation of the inhibitor and activation of NF-kappa-B. The encoded protein itself is found in a complex of proteins. Several transcript variants, some protein-coding and some not, have been found for this gene. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, Protein Kinase, Transcription Factors |
Protein Pathways | Acute myeloid leukemia, Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Cytosolic DNA-sensing pathway, Epithelial cell signaling in Helicobacter pylori infection, Insulin signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, NOD-like receptor signaling pathway, Pancreatic cancer, Pathways in cancer, Prostate cancer, RIG-I-like receptor signaling pathway, Small cell lung cancer, T cell receptor signaling pathway, Toll-like receptor signaling pathway, Type II diabetes mellitus |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Development of novel NEMO-binding domain mimetics for inhibiting IKK/NF-κB activation
,Zhao, J;Zhang, L;Mu, X;Doebelin, C;Nguyen, W;Wallace, C;Reay, DP;McGowan, SJ;Corbo, L;Clemens, PR;Wilson, GM;Watkins, SC;Solt, LA;Cameron, MD;Huard, J;Niedernhofer, LJ;Kamenecka, TM;Robbins, PD;,
PLoS Biol.
,PubMed ID 29889904
[IKBKB]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC419865 | IKBKB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY419865 | Transient overexpression lysate of inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta (IKBKB) |
CNY 4,840.00 |
|
PH319154 | IKBKB MS Standard C13 and N15-labeled recombinant protein (NP_001547) |
CNY 19,520.00 |
|
TP750220 | Purified recombinant protein of Human inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta (IKBKB), transcript variant 1, full length, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
其它IKK beta产品