United States
Germany
Japan
United Kingdom
China
MAGEA4 (NM_001011548) Human Recombinant Protein
CAT＃: TP318952
Purified recombinant protein of Homo sapiens melanoma antigen family A, 4 (MAGEA4), transcript variant 1, 20 µg
View other "MAGEA4" proteins (13)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
| Cited in 2 publications. |
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218952 representing NM_001011548
Red=Cloning site Green=Tags(s) MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGAS ALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERV IKNYKRCFPVIFGKASESLKMIFGIDVKEVDPASNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTI AMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 34.7 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | ELISA capture for autoantibodies (PMID: 27323861) ELISA capture for autoantibodies (PMID: 27793776) |
| Reference Data | |
| RefSeq | NP_001011548 |
| Locus ID | 4103 |
| UniProt ID | P43358 |
| Refseq Size | 1724 |
| Cytogenetics | Xq28 |
| Refseq ORF | 951 |
| Synonyms | CT1.4; MAGE-41; MAGE-X2; MAGE4; MAGE4A; MAGE4B |
| Summary | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Several variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2020] |
Citations (2)
| The use of this Proteins has been cited in the following citations: |
|---|
|
Case-Control Study: Smoking History Affects the Production of Tumor Antigen-Specific Antibodies NY-ESO-1 in Patients with Lung Cancer in Comparison with Cancer Disease-Free Group
,Myšíková, D;Adkins, I;Nad'a, H;Ondrej, P;Šimonek, J;Pozniak, J;Kolarík, J;Skallová-Fialová, A;Špíšek, R;Lischke, R;,
J Thorac Oncol
,PubMed ID 27793776
[MAGEA4]
|
|
Expression of tumor antigens on primary ovarian cancer cells compared to established ovarian cancer cell lines
,Kloudová, K;Hromádková, H;Partlová, S;Brtnický, T;Rob, L;Bartunková, J;Hensler, M;Halaška, MJ;Špíšek, R;Fialová, A;,
Oncotarget
,PubMed ID 27323861
[MAGEA4]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423276 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425301 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425302 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429096 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423276 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 4 |
CNY 3,080.00 |
|
| LY425301 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 1 |
CNY 3,080.00 |
|
| LY425302 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 3 |
CNY 3,080.00 |
|
| LY429096 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 2 |
CNY 3,080.00 |
|
| PH304482 | MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011549) |
CNY 14,250.00 |
|
| PH318952 | MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011548) |
CNY 14,250.00 |
|
| PH323991 | MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011550) |
CNY 19,520.00 |
|
| TP304482 | Purified recombinant protein of Homo sapiens melanoma antigen family A, 4 (MAGEA4), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP323991 | Recombinant protein of human melanoma antigen family A, 4 (MAGEA4), transcript variant 4, 20 µg |
CNY 2,900.00 |
