United States
Germany
Japan
United Kingdom
China
MAGEA4 (NM_001011550) Human Mass Spec Standard
CAT＃: PH323991
MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011550)
View other "MAGEA4" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 3,080.00
Specifications
| Product Data | |
| Description | MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011550) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223991 |
| Predicted MW | 34.9 kDa |
| Protein Sequence |
>RC223991 protein sequence
Red=Cloning site Green=Tags(s) MSSEQKSQHCKPEEGVEAQEEALGLVGAQAPTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGAS ALPTTISFTCWRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKELVTKAEMLERV IKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLVTCLGLSYDGLLGNNQIFPKTGLLIIVLGTI AMEGDSASEEEIWEELGVMGVYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001011550 |
| RefSeq Size | 1712 |
| RefSeq ORF | 951 |
| Synonyms | CT1.4; MAGE-41; MAGE-X2; MAGE4; MAGE4A; MAGE4B |
| Locus ID | 4103 |
| Cytogenetics | Xq28 |
| Summary | This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. Several variants encoding the same protein have been found for this gene. [provided by RefSeq, Aug 2020] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC423276 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425301 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425302 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429096 | MAGEA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY423276 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 4 |
CNY 3,080.00 |
|
| LY425301 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 1 |
CNY 3,080.00 |
|
| LY425302 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 3 |
CNY 3,080.00 |
|
| LY429096 | Transient overexpression lysate of melanoma antigen family A, 4 (MAGEA4), transcript variant 2 |
CNY 3,080.00 |
|
| PH304482 | MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011549) |
CNY 14,250.00 |
|
| PH318952 | MAGEA4 MS Standard C13 and N15-labeled recombinant protein (NP_001011548) |
CNY 14,250.00 |
|
| TP304482 | Purified recombinant protein of Homo sapiens melanoma antigen family A, 4 (MAGEA4), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP318952 | Purified recombinant protein of Homo sapiens melanoma antigen family A, 4 (MAGEA4), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP323991 | Recombinant protein of human melanoma antigen family A, 4 (MAGEA4), transcript variant 4, 20 µg |
CNY 2,900.00 |
