S100 Calcium Binding Protein A13 (S100A13) (NM_001024212) Human Recombinant Protein
CAT#: TP318914
Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 4, 20 µg
View other "S100 Calcium Binding Protein A13" proteins (19)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218914 protein sequence
Red=Cloning site Green=Tags(s) MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSE LKFNEYWRLIGELAKEIRKKKDLKIRKK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.3 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001019383 |
Locus ID | 6284 |
UniProt ID | Q99584 |
Refseq Size | 638 |
Cytogenetics | 1q21.3 |
Refseq ORF | 294 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416946 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422618 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422619 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422620 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC422621 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416946 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 2 |
CNY 3,080.00 |
|
LY422618 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 1 |
CNY 3,080.00 |
|
LY422619 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 3 |
CNY 3,080.00 |
|
LY422620 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 4 |
CNY 3,080.00 |
|
LY422621 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 5 |
CNY 3,080.00 |
|
PH310001 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019381) |
CNY 14,250.00 |
|
PH311660 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019382) |
CNY 14,250.00 |
|
PH311720 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019384) |
CNY 14,250.00 |
|
PH318914 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019383) |
CNY 14,250.00 |
|
PH322165 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_005970) |
CNY 19,520.00 |
|
TP310001 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP311660 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP311720 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
TP322165 | Recombinant protein of human S100 calcium binding protein A13 (S100A13), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它S100 Calcium Binding Protein A13产品