S100 Calcium Binding Protein A13 (S100A13) (NM_001024212) Human Mass Spec Standard
CAT#: PH318914
S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019383)
View other "S100 Calcium Binding Protein A13" proteins (19)
Need it in bulk or customized? Get a free quote |
CN¥ 14,250.00
Specifications
Product Data | |
Description | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019383) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC218914 |
Predicted MW | 11.5 kDa |
Protein Sequence |
>RC218914 protein sequence
Red=Cloning site Green=Tags(s) MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKMKSLDVNQDSE LKFNEYWRLIGELAKEIRKKKDLKIRKK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001019383 |
RefSeq Size | 638 |
RefSeq ORF | 294 |
Locus ID | 6284 |
Cytogenetics | 1q21.3 |
Summary | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein is widely expressed in various types of tissues with a high expression level in thyroid gland. In smooth muscle cells, this protein co-expresses with other family members in the nucleus and in stress fibers, suggesting diverse functions in signal transduction. Multiple alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416946 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC422618 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC422619 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC422620 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC422621 | S100A13 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY416946 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 2 |
CN¥ 3,080.00 |
|
LY422618 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 1 |
CN¥ 3,080.00 |
|
LY422619 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 3 |
CN¥ 3,080.00 |
|
LY422620 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 4 |
CN¥ 3,080.00 |
|
LY422621 | Transient overexpression lysate of S100 calcium binding protein A13 (S100A13), transcript variant 5 |
CN¥ 3,080.00 |
|
PH310001 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019381) |
CN¥ 14,250.00 |
|
PH311660 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019382) |
CN¥ 14,250.00 |
|
PH311720 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_001019384) |
CN¥ 14,250.00 |
|
PH322165 | S100A13 MS Standard C13 and N15-labeled recombinant protein (NP_005970) |
CN¥ 19,520.00 |
|
TP310001 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 1, 20 µg |
CN¥ 2,900.00 |
|
TP311660 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 3, 20 µg |
CN¥ 2,900.00 |
|
TP311720 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 5, 20 µg |
CN¥ 2,900.00 |
|
TP318914 | Purified recombinant protein of Homo sapiens S100 calcium binding protein A13 (S100A13), transcript variant 4, 20 µg |
CN¥ 2,900.00 |
|
TP322165 | Recombinant protein of human S100 calcium binding protein A13 (S100A13), transcript variant 2, 20 µg |
CN¥ 2,900.00 |
其它S100 Calcium Binding Protein A13产品