United States
Germany
Japan
United Kingdom
China
ELAVL4 (NM_021952) Human Recombinant Protein
CAT＃: TP318612
Recombinant protein of human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 1, 20 µg
View other "ELAVL4" proteins (9)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
热销蛋白，享双倍赠礼
CNY 2,900.00
CNY 6,650.00
| Cited in 1 publication. |
Product images
热销推荐CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC218612 representing NM_021952
Red=Cloning site Green=Tags(s) MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLP KTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA NNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACSPRFSPITIDG MTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE AAMAIASLNGYRLGDRVLQVSFKTNKAHKS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.6 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Bioactivity | EMSA reaction (PMID: 27801893) |
| Reference Data | |
| RefSeq | NP_068771 |
| Locus ID | 1996 |
| UniProt ID | P26378 |
| Refseq Size | 1591 |
| Cytogenetics | 1p33-p32.3 |
| Refseq ORF | 1140 |
| Synonyms | HUD; PNEM |
| Summary | May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3' UTR (By similarity). Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.[UniProtKB/Swiss-Prot Function] |
| Protein Families | Druggable Genome |
Citations (1)
| The use of this Proteins has been cited in the following citations: |
|---|
|
The DPYSL2 gene connects mTOR and schizophrenia
,Pham, X;Song, G;Lao, S;Goff, L;Zhu, H;Valle, D;Avramopoulos, D;,
Transl Psychiatry
,PubMed ID 27801893
[ELAVL4]
|
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC411863 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428514 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428515 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428517 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY411863 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 1 |
CNY 3,080.00 |
|
| LY428514 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 2 |
CNY 3,080.00 |
|
| LY428515 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 3 |
CNY 3,080.00 |
|
| LY428517 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 5 |
CNY 3,080.00 |
|
| PH318612 | ELAVL4 MS Standard C13 and N15-labeled recombinant protein (NP_068771) |
CNY 19,520.00 |
