ELAVL4 (NM_021952) Human Recombinant Protein
CAT#: TP318612
Recombinant protein of human ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 1, 20 µg
View other "ELAVL4" proteins (9)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Cited in 1 publication. |
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218612 representing NM_021952
Red=Cloning site Green=Tags(s) MVMIISTMEPQVSNGPTSNTSNGPSSNNRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIG EIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLP KTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA NNPSQKSSQALLSQLYQSPNRRYPGPLHHQAQRFRLDNLLNMAYGVKRLMSGPVPPSACSPRFSPITIDG MTSLVGMNIPGHTGTGWCIFVYNLSPDSDESVLWQLFGPFGAVNNVKVIRDFNTNKCKGFGFVTMTNYDE AAMAIASLNGYRLGDRVLQVSFKTNKAHKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Bioactivity | EMSA reaction (PMID: 27801893) |
Reference Data | |
RefSeq | NP_068771 |
Locus ID | 1996 |
UniProt ID | P26378 |
Refseq Size | 1591 |
Cytogenetics | 1p33-p32.3 |
Refseq ORF | 1140 |
Synonyms | HUD; PNEM |
Summary | May play a role in neuron-specific RNA processing. Protects CDKN1A mRNA from decay by binding to its 3' UTR (By similarity). Binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
The DPYSL2 gene connects mTOR and schizophrenia
,Pham, X;Song, G;Lao, S;Goff, L;Zhu, H;Valle, D;Avramopoulos, D;,
Transl Psychiatry
,PubMed ID 27801893
[ELAVL4]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411863 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428514 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428515 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LC428517 | ELAVL4 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 900.00 |
|
LY411863 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 1 |
CN¥ 3,080.00 |
|
LY428514 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 2 |
CN¥ 3,080.00 |
|
LY428515 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 3 |
CN¥ 3,080.00 |
|
LY428517 | Transient overexpression lysate of ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D) (ELAVL4), transcript variant 5 |
CN¥ 3,080.00 |
|
PH318612 | ELAVL4 MS Standard C13 and N15-labeled recombinant protein (NP_068771) |
CN¥ 19,520.00 |