ELAVL4 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ELAVL4 antibody: synthetic peptide directed towards the N terminal of human ELAVL4. Synthetic peptide located within the following region: MQTGATTDDSKTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	42 kDa
Gene Name	ELAV like neuron-specific RNA binding protein 4
Database Link	NP_068771 Entrez Gene 1996 Human UniProt ID P26378
Background	ELAVL4 may play a role in neuron-specific RNA processing. ELAVL4 protects CDKN1A mRNA from decay by binding to its 3' UTR By similarity. ELAVL4 binds to AU-rich sequences (AREs) of target mRNAs, including VEGF and FOS mRNA.
Synonyms	HUD; PNEM
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%; Zebrafish: 92%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.