CD59 (NM_000611) Human Recombinant Protein
CAT#: TP318343
Recombinant protein of human CD59 molecule, complement regulatory protein (CD59), transcript variant 2, 20 µg
View other "CD59" proteins (23)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218343 protein sequence
Red=Cloning site Green=Tags(s) MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHC NFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFLAAAWSLHP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 11.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000602 |
Locus ID | 966 |
UniProt ID | P13987 |
Refseq Size | 7635 |
Cytogenetics | 11p13 |
Refseq ORF | 384 |
Synonyms | 1F5; 16.3A5; EJ16; EJ30; EL32; G344; HRF-20; HRF20; MAC-IP; MACIF; MEM43; MIC11; MIN1; MIN2; MIN3; MIRL; MSK21; p18-20 |
Summary | This gene encodes a cell surface glycoprotein that regulates complement-mediated cell lysis, and it is involved in lymphocyte signal transduction. This protein is a potent inhibitor of the complement membrane attack complex, whereby it binds complement C8 and/or C9 during the assembly of this complex, thereby inhibiting the incorporation of multiple copies of C9 into the complex, which is necessary for osmolytic pore formation. This protein also plays a role in signal transduction pathways in the activation of T cells. Mutations in this gene cause CD59 deficiency, a disease resulting in hemolytic anemia and thrombosis, and which causes cerebral infarction. Multiple alternatively spliced transcript variants, which encode the same protein, have been identified for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Complement and coagulation cascades, Hematopoietic cell lineage |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404397 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404398 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC404399 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424608 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426723 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426724 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426725 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC426726 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430908 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430909 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC430910 | CD59 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404397 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 3 |
CNY 3,080.00 |
|
LY404398 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 1 |
CNY 3,080.00 |
|
LY404399 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 4 |
CNY 3,080.00 |
|
LY424608 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 2 |
CNY 3,080.00 |
|
LY426723 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 5 |
CNY 3,080.00 |
|
LY426724 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 6 |
CNY 3,080.00 |
|
LY426725 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 7 |
CNY 3,080.00 |
|
LY426726 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 8 |
CNY 3,080.00 |
|
LY430908 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 3 |
CNY 3,080.00 |
|
LY430909 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 1 |
CNY 3,080.00 |
|
LY430910 | Transient overexpression lysate of CD59 molecule, complement regulatory protein (CD59), transcript variant 4 |
CNY 3,080.00 |
|
PH318343 | CD59 MS Standard C13 and N15-labeled recombinant protein (NP_000602) |
CNY 19,520.00 |