RAD51 (NM_002875) Human Recombinant Protein
CAT#: TP318333
Recombinant protein of human RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 1, 20 µg
View other "RAD51" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC218333 representing NM_002875
Red=Cloning site Green=Tags(s) MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKELINIKGISEAK ADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETGSITEMFGEFRTGKTQICHTL AVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGLSGSDVLDNVAYARAFNTDHQTQLLYQASAM MVESRYALLIVDSATALYRTDYSGRGELSARQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFA ADPKKPIGGNIIAHASTTRLYLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 36.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002866 |
Locus ID | 5888 |
UniProt ID | Q06609 |
Refseq Size | 2254 |
Cytogenetics | 15q15.1 |
Refseq ORF | 1017 |
Synonyms | BRCC5; FANCR; HRAD51; HsRad51; HsT16930; MRMV2; RAD51A; RECA |
Summary | The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This protein can interact with the ssDNA-binding protein RPA and RAD52, and it is thought to play roles in homologous pairing and strand transfer of DNA. This protein is also found to interact with BRCA1 and BRCA2, which may be important for the cellular response to DNA damage. BRCA2 is shown to regulate both the intracellular localization and DNA-binding ability of this protein. Loss of these controls following BRCA2 inactivation may be a key event leading to genomic instability and tumorigenesis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Aug 2009] |
Protein Families | Druggable Genome, Stem cell - Pluripotency, Transcription Factors |
Protein Pathways | Homologous recombination, Pancreatic cancer, Pathways in cancer |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408818 | RAD51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC419044 | RAD51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC429121 | RAD51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431240 | RAD51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431300 | RAD51 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408818 | Transient overexpression lysate of RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 2 |
CNY 3,080.00 |
|
LY419044 | Transient overexpression lysate of RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 1 |
CNY 3,080.00 |
|
LY429121 | Transient overexpression lysate of RAD51 homolog (RecA homolog, E. coli) (S. cerevisiae) (RAD51), transcript variant 1 |
CNY 3,080.00 |
|
LY431240 | Transient overexpression lysate of RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 3 |
CNY 3,080.00 |
|
LY431300 | Transient overexpression lysate of RAD51 homolog (S. cerevisiae) (RAD51), transcript variant 4 |
CNY 3,080.00 |
|
PH318333 | RAD51 MS Standard C13 and N15-labeled recombinant protein (NP_002866) |
CNY 19,520.00 |