QDPR (NM_000320) Human Recombinant Protein
CAT#: TP317737
Recombinant protein of human quinoid dihydropteridine reductase (QDPR), 20 µg
View other "QDPR" proteins (4)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217737 representing NM_000320
Red=Cloning site Green=Tags(s) MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAE VGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAA LDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVE TFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 25.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000311 |
Locus ID | 5860 |
UniProt ID | P09417, A0A140VKA9 |
Refseq Size | 1550 |
Cytogenetics | 4p15.32 |
Refseq ORF | 732 |
Synonyms | DHPR; HDHPR; PKU2; SDR33C1 |
Summary | This gene encodes the enzyme dihydropteridine reductase, which catalyzes the NADH-mediated reduction of quinonoid dihydrobiopterin. This enzyme is an essential component of the pterin-dependent aromatic amino acid hydroxylating systems. Mutations in this gene resulting in QDPR deficiency include aberrant splicing, amino acid substitutions, insertions, or premature terminations. Dihydropteridine reductase deficiency presents as atypical phenylketonuria due to insufficient production of biopterin, a cofactor for phenylalanine hydroxylase. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Folate biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424801 | QDPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424801 | Transient overexpression lysate of quinoid dihydropteridine reductase (QDPR) |
CNY 3,080.00 |
|
PH317737 | QDPR MS Standard C13 and N15-labeled recombinant protein (NP_000311) |
CNY 19,520.00 |
|
TP720718 | Purified recombinant protein of Human quinoid dihydropteridine reductase (QDPR) |
CNY 3,140.00 |