QDPR (NM_000320) Human Mass Spec Standard
CAT#: PH317737
QDPR MS Standard C13 and N15-labeled recombinant protein (NP_000311)
View other "QDPR" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | QDPR MS Standard C13 and N15-labeled recombinant protein (NP_000311) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC217737 |
Predicted MW | 25.6 kDa |
Protein Sequence |
>RC217737 representing NM_000320
Red=Cloning site Green=Tags(s) MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAE VGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAA LDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVE TFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000311 |
RefSeq Size | 1550 |
RefSeq ORF | 732 |
Synonyms | DHPR; HDHPR; PKU2; SDR33C1 |
Locus ID | 5860 |
Cytogenetics | 4p15.32 |
Summary | This gene encodes the enzyme dihydropteridine reductase, which catalyzes the NADH-mediated reduction of quinonoid dihydrobiopterin. This enzyme is an essential component of the pterin-dependent aromatic amino acid hydroxylating systems. Mutations in this gene resulting in QDPR deficiency include aberrant splicing, amino acid substitutions, insertions, or premature terminations. Dihydropteridine reductase deficiency presents as atypical phenylketonuria due to insufficient production of biopterin, a cofactor for phenylalanine hydroxylase. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Folate biosynthesis, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424801 | QDPR HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424801 | Transient overexpression lysate of quinoid dihydropteridine reductase (QDPR) |
CNY 3,080.00 |
|
TP317737 | Recombinant protein of human quinoid dihydropteridine reductase (QDPR), 20 µg |
CNY 2,900.00 |
|
TP720718 | Purified recombinant protein of Human quinoid dihydropteridine reductase (QDPR) |
CNY 3,140.00 |