BAIAP2 (NM_017451) Human Recombinant Protein
CAT#: TP317285
Purified recombinant protein of Homo sapiens BAI1-associated protein 2 (BAIAP2), transcript variant 2, 20 µg
View other "BAIAP2" proteins (14)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
CNY 1,999.00
CNY 2,700.00
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC217285 representing NM_017451
Red=Cloning site Green=Tags(s) MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSK ELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAA YHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVP PELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK NSYATTENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESEK TKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQRP YSVAVPAFSQGLDDYGARSMSRNPFAHVQLKPTVTNDRCDLSAQGPEGREHGDGSARTLAGR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 60.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_059345 |
Locus ID | 10458 |
UniProt ID | Q9UQB8 |
Refseq Size | 2877 |
Cytogenetics | 17q25.3 |
Refseq ORF | 1656 |
Synonyms | BAP2; FLAF3; IRSP53; WAML |
Summary | The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jan 2009] |
Protein Families | Druggable Genome |
Protein Pathways | Adherens junction, Regulation of actin cytoskeleton |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401909 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC402587 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC413755 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429535 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401909 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 3 |
CNY 3,080.00 |
|
LY402587 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 1 |
CNY 3,080.00 |
|
LY413755 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 2 |
CNY 4,840.00 |
|
LY429535 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 2 |
CNY 3,080.00 |
|
PH304233 | BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059344) |
CNY 19,520.00 |
|
PH314570 | BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_006331) |
CNY 19,520.00 |
|
PH317285 | BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059345) |
CNY 14,250.00 |
|
TP304233 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP314570 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
TP710123 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells |
CNY 4,020.00 |