United States
Germany
Japan
United Kingdom
China
BAIAP2 (NM_017450) Human Mass Spec Standard
CAT＃: PH304233
BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059344)
View other "BAIAP2" proteins (14)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
| Product Data | |
| Description | BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059344) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC204233 |
| Predicted MW | 57.4 kDa |
| Protein Sequence |
>RC204233 protein sequence
Red=Cloning site Green=Tags(s) MSLSRSEEMHRLTENVYKTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKMGELASESQGSK ELGDVLFQMAEVHRQIQNQLEEMLKSFHNELLTQLEQKVELDSRYLSAALKKYQTEQRSKGDALDKCQAE LKKLRKKSQGSKNPQKYSDKELQYIDAISNKQGELENYVSDGYKTALTEERRRFCFLVEKQCAVAKNSAA YHSKGKELLAQKLPLWQQACADPSKIPERAVQLMQQVASNGATLPSALSASKSNLVISDPIPGAKPLPVP PELAPFVGRMSAQESTPIMNGVTGPDGEDYSPWADRKAAQPKSLSPPQSQSKLSDSYSNTLPVRKSVTPK NSYATTAENKTLPRSSSMAAGLERNGRMRVKAIFSHAAGDNSTLLSFKEGDLITLLVPEARDGWHYGESE KTKMRGWFPFSYTRVLDSDGSDRLHMSLQQGKSSSTGNLLDKDDLAIPPPDYGAASRAFPAQTASGFKQR PYSVAVPAFSQGLDDYGARSMSSGSGTLVSTV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_059344 |
| RefSeq Size | 3188 |
| RefSeq ORF | 1566 |
| Synonyms | BAP2; FLAF3; IRSP53; WAML |
| Locus ID | 10458 |
| Cytogenetics | 17q25.3 |
| Summary | The protein encoded by this gene has been identified as a brain-specific angiogenesis inhibitor (BAI1)-binding protein. This adaptor protein links membrane bound G-proteins to cytoplasmic effector proteins. This protein functions as an insulin receptor tyrosine kinase substrate and suggests a role for insulin in the central nervous system. It also associates with a downstream effector of Rho small G proteins, which is associated with the formation of stress fibers and cytokinesis. This protein is involved in lamellipodia and filopodia formation in motile cells and may affect neuronal growth-cone guidance. This protein has also been identified as interacting with the dentatorubral-pallidoluysian atrophy gene, which is associated with an autosomal dominant neurodegenerative disease. Alternative splicing results in multiple transcript variants encoding distinct isoforms.[provided by RefSeq, Jan 2009] |
| Protein Families | Druggable Genome |
| Protein Pathways | Adherens junction, Regulation of actin cytoskeleton |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401909 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC402587 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC413755 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC429535 | BAIAP2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401909 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 3 |
CNY 3,080.00 |
|
| LY402587 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 1 |
CNY 3,080.00 |
|
| LY413755 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 2 |
CNY 4,840.00 |
|
| LY429535 | Transient overexpression lysate of BAI1-associated protein 2 (BAIAP2), transcript variant 2 |
CNY 3,080.00 |
|
| PH314570 | BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_006331) |
CNY 19,520.00 |
|
| PH317285 | BAIAP2 MS Standard C13 and N15-labeled recombinant protein (NP_059345) |
CNY 14,250.00 |
|
| TP304233 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP314570 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP317285 | Purified recombinant protein of Homo sapiens BAI1-associated protein 2 (BAIAP2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP710123 | Recombinant protein of human BAI1-associated protein 2 (BAIAP2), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells |
CNY 4,020.00 |
