PCYT1B (NM_004845) Human Recombinant Protein
CAT#: TP316978
Recombinant protein of human phosphate cytidylyltransferase 1, choline, beta (PCYT1B), 20 µg
View other "PCYT1B" proteins (7)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Cited in 1 publication. |
CNY 600.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216978 representing NM_004845
Red=Cloning site Green=Tags(s) MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLG TPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCR YVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIV RDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEE KSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSS PKAASASISSMSEGDEDEK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 41.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004836 |
Locus ID | 9468 |
UniProt ID | Q9Y5K3 |
Refseq Size | 5447 |
Cytogenetics | Xp22.11 |
Refseq ORF | 1107 |
Synonyms | CCTB; CTB |
Summary | The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Citations (1)
The use of this Proteins has been cited in the following citations: |
---|
Cancer Malignancy Is Correlated with Upregulation of PCYT2-Mediated Glycerol Phosphate Modification of α-Dystroglycan
,null,
International Journal of Molecular Sciences
,PubMed ID 35743105
[PCYT1B]
|
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417711 | PCYT1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431289 | PCYT1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431865 | PCYT1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417711 | Transient overexpression lysate of phosphate cytidylyltransferase 1, choline, beta (PCYT1B), transcript variant 1 |
CNY 3,080.00 |
|
LY431289 | Transient overexpression lysate of phosphate cytidylyltransferase 1, choline, beta (PCYT1B), transcript variant 3 |
CNY 3,080.00 |
|
LY431865 | Transient overexpression lysate of phosphate cytidylyltransferase 1, choline, beta (PCYT1B), transcript variant 2 |
CNY 3,080.00 |
|
PH316978 | PCYT1B MS Standard C13 and N15-labeled recombinant protein (NP_004836) |
CNY 14,250.00 |