PCYT1B (NM_004845) Human Mass Spec Standard
CAT#: PH316978
PCYT1B MS Standard C13 and N15-labeled recombinant protein (NP_004836)
View other "PCYT1B" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | PCYT1B MS Standard C13 and N15-labeled recombinant protein (NP_004836) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC216978 |
Predicted MW | 41.8 kDa |
Protein Sequence |
>RC216978 representing NM_004845
Red=Cloning site Green=Tags(s) MPVVTTDAESETGIPKSLSNEPPSETMEEIEHTCPQPRLTLTAPAPFADETNCQCQAPHEKLTIAQARLG TPADRPVRVYADGIFDLFHSGHARALMQAKTLFPNSYLLVGVCSDDLTHKFKGFTVMNEAERYEALRHCR YVDEVIRDAPWTLTPEFLEKHKIDFVAHDDIPYSSAGSDDVYKHIKEAGMFVPTQRTEGISTSDIITRIV RDYDVYARRNLQRGYTAKELNVSFINEKRYRFQNQVDKMKEKVKNVEERSKEFVNRVEEKSHDLIQKWEE KSREFIGNFLELFGPDGAWKQMFQERSSRMLQALSPKQSPVSSPTRSRSPSRSPSPTFSWLPLKTSPPSS PKAASASISSMSEGDEDEK myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004836 |
RefSeq Size | 5447 |
RefSeq ORF | 1107 |
Synonyms | CCTB; CTB |
Locus ID | 9468 |
Cytogenetics | Xp22.11 |
Summary | The protein encoded by this gene belongs to the cytidylyltransferase family. It is involved in the regulation of phosphatidylcholine biosynthesis. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
Protein Families | Stem cell - Pluripotency |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC417711 | PCYT1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431289 | PCYT1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC431865 | PCYT1B HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY417711 | Transient overexpression lysate of phosphate cytidylyltransferase 1, choline, beta (PCYT1B), transcript variant 1 |
CNY 3,080.00 |
|
LY431289 | Transient overexpression lysate of phosphate cytidylyltransferase 1, choline, beta (PCYT1B), transcript variant 3 |
CNY 3,080.00 |
|
LY431865 | Transient overexpression lysate of phosphate cytidylyltransferase 1, choline, beta (PCYT1B), transcript variant 2 |
CNY 3,080.00 |
|
TP316978 | Recombinant protein of human phosphate cytidylyltransferase 1, choline, beta (PCYT1B), 20 µg |
CNY 2,900.00 |