CD22 (NM_001771) Human Recombinant Protein
CAT#: TP316939
Recombinant protein of human CD22 molecule (CD22), 20 µg
View other "CD22" proteins (11)
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CN¥ 2,900.00
CN¥ 6,650.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC216939 representing NM_001771
Red=Cloning site Green=Tags(s) MHLLGPWLLLLVLEYLAFSDSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSK FDGTRLYESTKDGKVPSEQKRVQFLGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERP FPPHIQLPPEIQESQEVTLTCLLNFSCYGYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQW SHHGKIVTCQLQDADGKFLSNDTVQLNVKHTPKLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWL KDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVGPGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVE FLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWHAGTYSCVAENILGTGQRGPGAELDVQYPPK KVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACARCNSW CSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKEVQFFWEKNGRLLGKESQLNFDS ISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSATLTCESDANPPVSHYTWF DWNNQSLPHHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETIGRRVAVGLGSCLAILI LAICGLKLQRRWKRTQSQQGLQENSSGQSFFVRNKKVRRAPLSEGPHSLGCYNPMMEDGISYTTLRFPEM NIPRTGDAESSEMQRPPRTCDDTVTYSALHKRQVGDYENVIPDFPEDEGIHYSELIQFGVGERPQAQENV DYVILKH myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 95.2 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001762 |
Locus ID | 933 |
UniProt ID | P20273 |
Refseq Size | 3300 |
Cytogenetics | 19q13.12 |
Refseq ORF | 2541 |
Synonyms | SIGLEC-2; SIGLEC2 |
Summary | Mediates B-cell B-cell interactions. May be involved in the localization of B-cells in lymphoid tissues. Binds sialylated glycoproteins; one of which is CD45. Preferentially binds to alpha-2,6-linked sialic acid. The sialic acid recognition site can be masked by cis interactions with sialic acids on the same cell surface. Upon ligand induced tyrosine phosphorylation in the immune response seems to be involved in regulation of B-cell antigen receptor signaling. Plays a role in positive regulation through interaction with Src family tyrosine kinases and may also act as an inhibitory receptor by recruiting cytoplasmic phosphatases via their SH2 domains that block signal transduction through dephosphorylation of signaling molecules.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | B cell receptor signaling pathway, Cell adhesion molecules (CAMs), Hematopoietic cell lineage |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC434364 | CD22 HEK293T cell transient overexpression lysate (as WB positive control) |
CN¥ 1,470.00 |
|
LY434364 | Transient overexpression lysate of CD22 molecule (CD22), transcript variant 4 |
CN¥ 4,840.00 |
|
PH316939 | CD22 MS Standard C13 and N15-labeled recombinant protein (NP_001762) |
CN¥ 19,520.00 |
|
TP721302 | Human CD22 Protein (C-His) |
CN¥ 2,450.00 |
|
TP721303 | Human CD22 Protein (C-His-Avi) |
CN¥ 2,450.00 |
|
TP721304 | Biotinylated Human CD22 Protein (C-His-Avi) |
CN¥ 3,480.00 |
|
TP721305 | PE Conjugated Human CD22 Protein (C-His) |
CN¥ 3,480.00 |
|
TP721306 | APC Conjugated Human CD22 Protein (C-His) |
CN¥ 3,480.00 |
|
TP721307 | Human CD22 Protein (C-Fc) |
CN¥ 2,450.00 |
|
TP723928 | Human CD22 Protein, hFc-His Tag |
CN¥ 5,876.00 |
|
TP762390 | Purified recombinant protein of Human CD22 molecule (CD22), transcript variant 1, Asp20-Ala330, with N-terminal His tag, expressed in E.coli, 50ug |
CN¥ 1,950.00 |