United States
Germany
Japan
United Kingdom
China
Septin 8 (SEPT8) (NM_001098813) Human Recombinant Protein
CAT＃: TP316253
Recombinant protein of human septin 8 (SEPT8), transcript variant 4, 20 µg
View other "Septin 8" proteins (11)
|
Need it in bulk or customized? Get a free quote |
Avi-tag Biotinylated Protein Get a free quote |
CNY 2,900.00
CNY 6,650.00
Product images
CNY 600.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC216253 representing NM_001098813
Red=Cloning site Green=Tags(s) MNTLFNTTFETEEASHHEACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFEN YLQEELKIRRSLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFK IKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENH CDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRK EEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQS QALHATSQQPLRKDKDKKN myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 43.3 kDa |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001092283 |
| Locus ID | 23176 |
| UniProt ID | Q92599 |
| Refseq Size | 4270 |
| Cytogenetics | 5q31.1 |
| Refseq ORF | 1107 |
| Synonyms | SEP2; SEPT8 |
| Summary | This gene is a member of the septin family of nucleotide binding proteins, originally described in yeast as cell division cycle regulatory proteins. Septins are highly conserved in yeast, Drosophila, and mouse, and appear to regulate cytoskeletal organization. Disruption of septin function disturbs cytokinesis and results in large multinucleate or polyploid cells. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414742 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC420343 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC420345 | 42255 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY414742 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 2 |
CNY 4,840.00 |
|
| LY420343 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 1 |
CNY 4,840.00 |
|
| LY420345 | Transient overexpression lysate of septin 8 (SEPT8), transcript variant 4 |
CNY 3,080.00 |
|
| PH313550 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_055961) |
CNY 14,250.00 |
|
| PH316253 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092283) |
CNY 19,520.00 |
|
| PH322095 | SEPT8 MS Standard C13 and N15-labeled recombinant protein (NP_001092281) |
CNY 14,250.00 |
|
| TP313550 | Purified recombinant protein of Homo sapiens septin 8 (SEPT8), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP322095 | Recombinant protein of human septin 8 (SEPT8), transcript variant 1, 20 µg |
CNY 2,900.00 |
其它Septin 8产品
